RL7A - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL7A - 50S ribosomal protein L7Ae

UniProt:	Q9HQH8	Sequences: MPVYVDYDVPADLQERALESLEVARDTGSVKKGTNETTKAIERGNADIVFVAEDVSPEEIVMHLPELAAEKGIEVVFVETQDELGNAAGLEVGSAAAAVVAAGDAEDEIEDISTKVEDLQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	120 (116)
Sequences:	649 (335)
Seq/√Len:	31.1

HALSA - RL7A
SULSO - RL7A

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
51_V	61_V	4.700	1.00
17_A	112_I	2.908	1.00
51_V	64_L	2.882	1.00
21_L	50_F	2.528	1.00
4_Y	58_E	2.452	0.99
41_I	73_I	2.375	0.99
49_V	68_A	2.297	0.99
106_E	110_E	2.268	0.99
14_Q	79_E	2.189	0.99
38_T	63_H	1.968	0.97
48_I	99_V	1.951	0.97
110_E	114_T	1.934	0.97
46_A	98_A	1.884	0.96
68_A	77_F	1.844	0.96
9_V	53_E	1.794	0.95
17_A	50_F	1.687	0.93
59_E	62_M	1.686	0.93
82_D	97_A	1.685	0.93
113_S	116_V	1.648	0.92
22_E	26_D	1.637	0.92
103_G	109_I	1.592	0.91
49_V	98_A	1.589	0.91
44_G	81_Q	1.543	0.89
12_D	19_E	1.539	0.89
32_K	36_E	1.510	0.88
30_V	54_D	1.509	0.88
18_L	79_E	1.506	0.88
16_R	115_K	1.453	0.86
73_I	114_T	1.445	0.86
16_R	111_D	1.440	0.86
54_D	82_D	1.433	0.86
54_D	80_T	1.419	0.85
105_A	109_I	1.405	0.84
38_T	67_L	1.372	0.83
40_A	98_A	1.372	0.83
78_V	84_L	1.326	0.81
11_A	15_E	1.325	0.81
88_A	94_S	1.308	0.80
41_I	71_K	1.292	0.79
90_L	95_A	1.247	0.76
35_N	59_E	1.229	0.75
37_T	49_V	1.225	0.75
20_S	112_I	1.212	0.74
18_L	88_A	1.182	0.72
30_V	72_G	1.181	0.72
19_E	23_V	1.144	0.70
69_A	91_E	1.143	0.70
48_I	116_V	1.134	0.69
34_T	39_K	1.125	0.69
17_A	76_V	1.119	0.68
82_D	86_N	1.117	0.68
52_A	81_Q	1.094	0.66
21_L	97_A	1.081	0.65
53_E	83_E	1.048	0.63
21_L	84_L	1.038	0.62
36_E	39_K	1.033	0.62
9_V	13_L	1.026	0.61
36_E	59_E	1.021	0.61
25_R	28_G	1.011	0.60
48_I	87_A	1.011	0.60
54_D	85_G	1.002	0.59
20_S	109_I	0.974	0.57
77_F	109_I	0.968	0.57
85_G	95_A	0.967	0.57
56_S	108_E	0.964	0.56
6_D	77_F	0.961	0.56
51_V	62_M	0.945	0.55
9_V	24_A	0.945	0.55
34_T	95_A	0.931	0.54
17_A	113_S	0.927	0.54
23_V	107_D	0.924	0.53
111_D	118_D	0.913	0.52
62_M	66_E	0.910	0.52
64_L	71_K	0.897	0.51
80_T	106_E	0.894	0.51
30_V	104_D	0.880	0.50
81_Q	96_A	0.879	0.50
24_A	79_E	0.878	0.50
60_I	88_A	0.877	0.49
21_L	78_V	0.870	0.49
99_V	111_D	0.862	0.48
8_D	41_I	0.858	0.48
5_V	8_D	0.837	0.46
3_V	18_L	0.829	0.46
56_S	64_L	0.799	0.43
49_V	70_E	0.795	0.43
101_A	114_T	0.794	0.43
46_A	71_K	0.777	0.41
30_V	113_S	0.765	0.41
32_K	96_A	0.758	0.40
14_Q	76_V	0.757	0.40
31_K	36_E	0.756	0.40
12_D	16_R	0.755	0.40
56_S	115_K	0.753	0.40
90_L	97_A	0.752	0.40
37_T	91_E	0.747	0.39
113_S	117_E	0.746	0.39
16_R	66_E	0.735	0.38
34_T	67_L	0.735	0.38
14_Q	17_A	0.732	0.38
14_Q	73_I	0.730	0.38
32_K	94_S	0.730	0.38
108_E	111_D	0.728	0.38
34_T	63_H	0.724	0.37
18_L	80_T	0.723	0.37
62_M	82_D	0.711	0.36
101_A	104_D	0.706	0.36
40_A	77_F	0.704	0.36
105_A	108_E	0.691	0.35
44_G	71_K	0.690	0.35
49_V	77_F	0.689	0.35
10_P	44_G	0.684	0.34
23_V	104_D	0.683	0.34
88_A	96_A	0.681	0.34
34_T	93_G	0.673	0.34
3_V	88_A	0.673	0.34
21_L	48_I	0.672	0.34
108_E	112_I	0.669	0.33
56_S	59_E	0.668	0.33
78_V	102_A	0.668	0.33
55_V	76_V	0.667	0.33
18_L	40_A	0.664	0.33
35_N	38_T	0.660	0.33
10_P	99_V	0.650	0.32
38_T	62_M	0.645	0.32
31_K	85_G	0.641	0.31
12_D	75_V	0.630	0.31
17_A	26_D	0.628	0.30
79_E	111_D	0.625	0.30
14_Q	18_L	0.618	0.30
20_S	26_D	0.614	0.30
86_N	107_D	0.612	0.29
53_E	74_E	0.610	0.29
58_E	92_V	0.610	0.29
46_A	49_V	0.607	0.29
75_V	81_Q	0.602	0.29
22_E	86_N	0.596	0.28
78_V	83_E	0.594	0.28
49_V	100_V	0.594	0.28
101_A	112_I	0.594	0.28
107_D	116_V	0.593	0.28
64_L	102_A	0.587	0.28
43_R	67_L	0.578	0.27
114_T	117_E	0.576	0.27
49_V	61_V	0.573	0.27
38_T	89_G	0.573	0.27
47_D	53_E	0.571	0.27
38_T	71_K	0.566	0.26
17_A	116_V	0.566	0.26
11_A	50_F	0.565	0.26
72_G	114_T	0.561	0.26
51_V	87_A	0.556	0.26
30_V	88_A	0.554	0.26
42_E	55_V	0.550	0.25
64_L	84_L	0.550	0.25
4_Y	7_Y	0.542	0.25
7_Y	77_F	0.541	0.25
71_K	108_E	0.539	0.25
10_P	115_K	0.536	0.25
28_G	83_E	0.533	0.24
45_N	100_V	0.531	0.24
3_V	8_D	0.531	0.24
15_E	19_E	0.530	0.24
16_R	40_A	0.527	0.24
84_L	94_S	0.522	0.24
7_Y	47_D	0.521	0.24
4_Y	46_A	0.520	0.24
31_K	100_V	0.520	0.24
36_E	85_G	0.520	0.24
22_E	81_Q	0.519	0.24
4_Y	59_E	0.518	0.23
40_A	100_V	0.505	0.23
50_F	97_A	0.505	0.23
63_H	75_V	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3o85A	1	1	100	0.388	Contact Map
2aifA	1	0.9417	100	0.388	Contact Map
2jnbA	1	1	100	0.391	Contact Map
4nutA	1	1	100	0.394	Contact Map
1vq8F	1	0.9917	99.9	0.429	Contact Map
3j60M	1	0.9333	99.9	0.43	Contact Map
2fc3A	1	0.9917	99.9	0.435	Contact Map
4bw0B	1	0.975	99.9	0.438	Contact Map
2lbwA	1	0.9167	99.9	0.448	Contact Map
1xbiA	1	0.9667	99.9	0.46	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.