EF1B - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

EF1B - Elongation factor 1-beta

UniProt:	Q9HQG6	Sequences: MSKVAAVLKVMPDSPDIDLDGLEADLSESLPDGAEINGTDTEEVAFGLTALLTTVIVPDDSGGTEAVEDAFGAVDDVESVSVEEVGRL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	88 (87)
Sequences:	155 (112)
Seq/√Len:	12.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
14_S	22_L	3.611	0.99
11_M	79_S	3.456	0.98
23_E	41_T	2.529	0.90
18_D	21_G	2.499	0.89
15_P	49_T	2.387	0.87
82_V	87_R	2.153	0.80
21_G	25_D	2.113	0.79
45_A	63_G	1.923	0.72
33_G	87_R	1.852	0.69
2_S	59_D	1.785	0.66
10_V	28_E	1.688	0.61
19_L	26_L	1.672	0.60
20_D	23_E	1.623	0.58
6_A	64_T	1.623	0.58
39_T	53_T	1.622	0.58
32_D	45_A	1.600	0.57
42_E	61_S	1.560	0.55
52_L	83_E	1.512	0.53
41_T	49_T	1.468	0.50
72_G	80_V	1.462	0.50
11_M	78_E	1.436	0.49
8_L	73_A	1.380	0.46
17_I	65_E	1.379	0.46
7_V	10_V	1.373	0.46
24_A	28_E	1.335	0.44
6_A	63_G	1.333	0.44
4_V	57_V	1.303	0.42
28_E	73_A	1.298	0.42
43_E	81_S	1.289	0.41
61_S	87_R	1.286	0.41
71_F	74_V	1.248	0.39
30_L	53_T	1.245	0.39
30_L	68_E	1.219	0.38
37_N	56_I	1.208	0.38
6_A	57_V	1.207	0.37
56_I	59_D	1.174	0.36
35_E	40_D	1.160	0.35
55_V	59_D	1.149	0.35
11_M	15_P	1.121	0.34
22_L	74_V	1.057	0.31
44_V	50_A	1.025	0.29
78_E	84_E	1.014	0.29
13_D	17_I	1.013	0.29
66_A	69_D	1.006	0.29
5_A	11_M	0.976	0.27
5_A	68_E	0.967	0.27
28_E	66_A	0.955	0.27
58_P	86_G	0.945	0.26
17_I	22_L	0.941	0.26
29_S	44_V	0.941	0.26
45_A	82_V	0.908	0.25
4_V	64_T	0.906	0.25
14_S	17_I	0.906	0.25
27_S	44_V	0.896	0.24
64_T	68_E	0.890	0.24
16_D	22_L	0.888	0.24
65_E	85_V	0.888	0.24
49_T	61_S	0.875	0.24
14_S	21_G	0.870	0.23
29_S	79_S	0.870	0.23
2_S	69_D	0.859	0.23
55_V	67_V	0.855	0.23
38_G	54_T	0.846	0.22
26_L	71_F	0.843	0.22
29_S	32_D	0.824	0.22
43_E	67_V	0.813	0.21
48_L	62_G	0.802	0.21
16_D	81_S	0.797	0.21
26_L	33_G	0.795	0.21
19_L	87_R	0.792	0.21
31_P	82_V	0.788	0.21
6_A	68_E	0.784	0.20
55_V	82_V	0.781	0.20
2_S	61_S	0.780	0.20
30_L	36_I	0.778	0.20
15_P	41_T	0.756	0.19
6_A	34_A	0.749	0.19
3_K	18_D	0.733	0.19
60_D	83_E	0.725	0.19
9_K	25_D	0.725	0.19
26_L	78_E	0.725	0.19
37_N	45_A	0.723	0.18
22_L	25_D	0.707	0.18
20_D	41_T	0.694	0.18
29_S	74_V	0.693	0.18
24_A	77_V	0.688	0.17
29_S	36_I	0.687	0.17
4_V	63_G	0.684	0.17
35_E	51_L	0.678	0.17
63_G	68_E	0.668	0.17
25_D	60_D	0.665	0.17
24_A	32_D	0.660	0.17
8_L	71_F	0.658	0.17
34_A	59_D	0.654	0.16
10_V	80_V	0.649	0.16
36_I	74_V	0.639	0.16
41_T	53_T	0.633	0.16
45_A	77_V	0.630	0.16
34_A	52_L	0.624	0.16
9_K	83_E	0.622	0.16
6_A	32_D	0.621	0.16
16_D	66_A	0.618	0.15
28_E	72_G	0.615	0.15
2_S	49_T	0.606	0.15
39_T	71_F	0.604	0.15
7_V	57_V	0.603	0.15
42_E	75_D	0.602	0.15
13_D	37_N	0.587	0.15
10_V	39_T	0.582	0.15
60_D	81_S	0.578	0.14
15_P	71_F	0.576	0.14
22_L	71_F	0.572	0.14
59_D	70_A	0.571	0.14
3_K	24_A	0.569	0.14
43_E	54_T	0.557	0.14
67_V	71_F	0.555	0.14
25_D	28_E	0.552	0.14
32_D	69_D	0.549	0.14
28_E	60_D	0.547	0.14
10_V	58_P	0.542	0.14
34_A	81_S	0.534	0.13
24_A	27_S	0.530	0.13
67_V	79_S	0.529	0.13
19_L	59_D	0.519	0.13
31_P	64_T	0.516	0.13
37_N	41_T	0.512	0.13
2_S	84_E	0.511	0.13
43_E	61_S	0.510	0.13
9_K	75_D	0.507	0.13
1_M	12_P	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1gh8A	1	1	99.9	0.274	Contact Map
2yy3A	1	1	99.9	0.277	Contact Map
1b64A	1	1	99.9	0.291	Contact Map
1f60B	1	1	99.9	0.297	Contact Map
4r86A	1	0.9659	30.2	0.902	Contact Map
4q2lA	1	0.4318	29.3	0.902	Contact Map
2djwA	6	0.875	25.6	0.905	Contact Map
3w9iA	3	0.9318	22.3	0.908	Contact Map
4mt1A	3	0.9205	21.4	0.909	Contact Map
2zbcA	6	0.8636	20.7	0.909	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.