Q9HQF9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQF9 - Flagellin A1

UniProt:	Q9HQF9	Sequences: MESMRRGQVGIGTLVVFMAMILVAAMAASTLVDIGGMLQSRGDATGEEAVGQVTNGVSVTGAFGTITNATDDPFTDGTVSDIEIVVGQSAGSGNVNVSDVTVDWVGPRQATTLSWTDGTANSSRFTTRKATGNSATVLADAEDRIEIVINATAVEENQDSFSGTSNDNHGLYAGERAELVITTQYGASTTYWVSVPESVTGASAVSV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	207 (187)
Sequences:	306 (248)
Seq/√Len:	18.1

HALSA - Q9HQF9 FLAA1 FLAB2 FLAB3 FLAA2 FLAB1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
49_A	52_Q	4.587	1.00
195_V	199_V	4.376	1.00
65_T	80_S	4.084	1.00
37_M	49_A	3.491	1.00
177_A	193_V	2.994	0.99
41_R	54_T	2.256	0.93
6_R	29_S	2.209	0.93
142_E	147_I	2.204	0.93
139_A	144_R	2.166	0.92
67_T	80_S	2.151	0.92
20_M	31_L	2.142	0.92
20_M	90_A	2.067	0.90
134_S	137_V	2.061	0.90
139_A	142_E	1.958	0.87
134_S	150_N	1.937	0.87
29_S	174_G	1.857	0.84
9_V	16_V	1.849	0.84
56_G	89_S	1.846	0.84
137_V	140_D	1.821	0.83
29_S	35_G	1.820	0.83
7_G	16_V	1.796	0.82
179_L	191_Y	1.788	0.82
35_G	85_V	1.757	0.81
113_L	127_T	1.737	0.80
16_V	101_T	1.733	0.80
31_L	35_G	1.731	0.80
183_T	195_V	1.724	0.79
6_R	9_V	1.706	0.79
174_G	184_Q	1.684	0.78
26_M	35_G	1.667	0.77
14_L	25_A	1.664	0.77
7_G	33_D	1.660	0.77
9_V	43_D	1.641	0.76
104_W	171_L	1.637	0.76
49_A	58_S	1.635	0.76
105_V	177_A	1.634	0.76
88_Q	179_L	1.618	0.75
179_L	193_V	1.519	0.70
52_Q	58_S	1.516	0.70
47_E	51_G	1.503	0.69
186_G	196_P	1.500	0.69
9_V	63_F	1.497	0.69
54_T	189_T	1.491	0.68
185_Y	188_S	1.465	0.67
26_M	41_R	1.423	0.65
37_M	52_Q	1.399	0.63
132_G	143_D	1.382	0.62
50_V	54_T	1.378	0.62
89_S	183_T	1.371	0.62
123_S	128_R	1.358	0.61
11_I	17_F	1.337	0.60
135_A	140_D	1.330	0.59
175_E	199_V	1.329	0.59
21_I	36_G	1.321	0.59
49_A	145_I	1.310	0.58
129_K	132_G	1.293	0.57
4_M	44_A	1.264	0.55
143_D	147_I	1.263	0.55
31_L	45_T	1.261	0.55
9_V	178_E	1.255	0.55
16_V	66_I	1.242	0.54
13_T	27_A	1.206	0.52
102_V	146_E	1.197	0.51
22_L	36_G	1.189	0.51
41_R	50_V	1.188	0.51
33_D	37_M	1.169	0.50
11_I	19_A	1.168	0.49
68_N	124_R	1.167	0.49
102_V	127_T	1.137	0.48
37_M	47_E	1.133	0.47
9_V	29_S	1.128	0.47
7_G	37_M	1.126	0.47
56_G	189_T	1.106	0.46
82_I	104_W	1.105	0.46
183_T	199_V	1.102	0.45
174_G	185_Y	1.084	0.44
121_N	170_G	1.082	0.44
86_V	123_S	1.081	0.44
35_G	44_A	1.069	0.43
57_V	95_V	1.062	0.43
150_N	155_E	1.061	0.43
33_D	49_A	1.059	0.43
10_G	14_L	1.058	0.43
44_A	58_S	1.055	0.43
24_A	27_A	1.049	0.42
52_Q	183_T	1.046	0.42
86_V	147_I	1.034	0.41
7_G	23_V	1.033	0.41
92_S	187_A	1.027	0.41
163_G	167_D	1.026	0.41
68_N	102_V	1.009	0.40
132_G	138_L	1.009	0.40
140_D	150_N	0.989	0.39
41_R	59_V	0.981	0.38
54_T	90_A	0.969	0.37
69_A	133_N	0.960	0.37
57_V	99_D	0.960	0.37
80_S	164_T	0.956	0.37
6_R	47_E	0.951	0.36
35_G	199_V	0.951	0.36
16_V	31_L	0.949	0.36
15_V	18_M	0.948	0.36
13_T	25_A	0.945	0.36
85_V	88_Q	0.944	0.36
98_S	125_F	0.942	0.36
69_A	123_S	0.942	0.36
44_A	192_W	0.940	0.36
118_G	121_N	0.939	0.36
150_N	153_A	0.939	0.36
78_T	201_G	0.934	0.35
50_V	56_G	0.933	0.35
16_V	37_M	0.931	0.35
10_G	18_M	0.930	0.35
12_G	20_M	0.926	0.35
12_G	17_F	0.908	0.34
120_A	123_S	0.907	0.34
15_V	19_A	0.904	0.34
95_V	182_T	0.899	0.34
84_I	104_W	0.896	0.33
39_Q	45_T	0.891	0.33
41_R	45_T	0.887	0.33
10_G	17_F	0.885	0.33
10_G	19_A	0.879	0.32
87_G	194_S	0.877	0.32
117_D	123_S	0.871	0.32
116_T	120_A	0.871	0.32
127_T	130_A	0.871	0.32
181_I	191_Y	0.869	0.32
127_T	131_T	0.865	0.32
50_V	183_T	0.863	0.32
21_I	50_V	0.855	0.31
21_I	34_I	0.852	0.31
13_T	36_G	0.852	0.31
29_S	44_A	0.852	0.31
137_V	150_N	0.850	0.31
29_S	113_L	0.846	0.31
151_A	155_E	0.843	0.31
116_T	119_T	0.839	0.30
24_A	34_I	0.835	0.30
82_I	107_P	0.834	0.30
37_M	59_V	0.834	0.30
140_D	144_R	0.830	0.30
60_T	111_T	0.821	0.29
134_S	140_D	0.821	0.29
116_T	128_R	0.818	0.29
122_S	125_F	0.814	0.29
120_A	168_N	0.809	0.29
59_V	138_L	0.808	0.29
163_G	166_N	0.808	0.29
51_G	115_W	0.807	0.29
118_G	124_R	0.806	0.29
88_Q	95_V	0.801	0.28
143_D	164_T	0.799	0.28
40_S	93_G	0.798	0.28
3_S	92_S	0.797	0.28
69_A	78_T	0.795	0.28
19_A	30_T	0.791	0.28
118_G	131_T	0.789	0.28
13_T	24_A	0.786	0.28
151_A	171_L	0.773	0.27
29_S	43_D	0.771	0.27
163_G	168_N	0.767	0.27
44_A	97_V	0.758	0.26
10_G	15_V	0.753	0.26
135_A	155_E	0.753	0.26
113_L	180_V	0.752	0.26
13_T	33_D	0.752	0.26
35_G	40_S	0.747	0.26
117_D	120_A	0.747	0.26
135_A	179_L	0.747	0.26
50_V	184_Q	0.745	0.26
54_T	97_V	0.745	0.26
120_A	170_G	0.744	0.26
54_T	61_G	0.741	0.25
44_A	50_V	0.739	0.25
4_M	47_E	0.739	0.25
123_S	153_A	0.737	0.25
56_G	88_Q	0.729	0.25
36_G	50_V	0.728	0.25
36_G	45_T	0.724	0.25
37_M	62_A	0.722	0.25
63_F	201_G	0.721	0.25
34_I	42_G	0.715	0.24
178_E	182_T	0.712	0.24
17_F	23_V	0.710	0.24
127_T	132_G	0.703	0.24
40_S	55_N	0.702	0.24
6_R	33_D	0.698	0.23
106_G	195_V	0.693	0.23
80_S	200_T	0.693	0.23
16_V	174_G	0.692	0.23
12_G	15_V	0.686	0.23
191_Y	194_S	0.683	0.23
89_S	185_Y	0.682	0.23
59_V	180_V	0.682	0.23
82_I	139_A	0.680	0.23
19_A	28_A	0.679	0.23
88_Q	92_S	0.679	0.23
7_G	48_E	0.670	0.22
116_T	163_G	0.668	0.22
48_E	68_N	0.662	0.22
78_T	167_D	0.660	0.22
37_M	58_S	0.659	0.22
126_T	148_V	0.656	0.22
40_S	190_T	0.650	0.21
197_E	200_T	0.645	0.21
16_V	49_A	0.642	0.21
13_T	21_I	0.639	0.21
59_V	94_N	0.639	0.21
36_G	187_A	0.635	0.21
16_V	90_A	0.631	0.21
21_I	33_D	0.631	0.21
67_T	76_D	0.628	0.21
18_M	30_T	0.627	0.20
56_G	183_T	0.627	0.20
140_D	149_I	0.625	0.20
130_A	143_D	0.624	0.20
41_R	185_Y	0.622	0.20
9_V	61_G	0.619	0.20
23_V	31_L	0.618	0.20
69_A	148_V	0.613	0.20
14_L	18_M	0.611	0.20
59_V	113_L	0.609	0.20
57_V	94_N	0.606	0.20
94_N	189_T	0.604	0.20
152_T	155_E	0.603	0.20
30_T	35_G	0.599	0.19
37_M	56_G	0.598	0.19
65_T	81_D	0.596	0.19
44_A	54_T	0.593	0.19
31_L	39_Q	0.593	0.19
14_L	17_F	0.588	0.19
51_G	100_V	0.588	0.19
20_M	198_S	0.587	0.19
15_V	91_G	0.585	0.19
26_M	199_V	0.577	0.19
11_I	15_V	0.577	0.19
55_N	62_A	0.576	0.19
119_T	168_N	0.575	0.18
16_V	198_S	0.573	0.18
19_A	46_G	0.571	0.18
122_S	128_R	0.570	0.18
37_M	199_V	0.570	0.18
184_Q	191_Y	0.564	0.18
84_I	153_A	0.564	0.18
3_S	44_A	0.556	0.18
52_Q	63_F	0.554	0.18
23_V	48_E	0.554	0.18
14_L	19_A	0.552	0.18
32_V	50_V	0.548	0.17
176_R	180_V	0.548	0.17
68_N	126_T	0.546	0.17
7_G	18_M	0.544	0.17
80_S	117_D	0.541	0.17
134_S	144_R	0.539	0.17
93_G	185_Y	0.538	0.17
141_A	200_T	0.537	0.17
79_V	170_G	0.536	0.17
60_T	63_F	0.536	0.17
109_Q	181_I	0.535	0.17
135_A	139_A	0.535	0.17
17_F	21_I	0.534	0.17
128_R	131_T	0.531	0.17
107_P	175_E	0.530	0.17
97_V	101_T	0.530	0.17
4_M	37_M	0.529	0.17
69_A	129_K	0.528	0.17
40_S	56_G	0.528	0.17
44_A	47_E	0.527	0.17
123_S	126_T	0.523	0.17
82_I	111_T	0.521	0.17
87_G	187_A	0.519	0.16
41_R	89_S	0.514	0.16
5_R	8_Q	0.512	0.16
37_M	41_R	0.509	0.16
3_S	102_V	0.505	0.16
132_G	135_A	0.505	0.16
89_S	179_L	0.503	0.16
59_V	189_T	0.502	0.16
80_S	166_N	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1gutA	5	0.3237	3.3	0.968	Contact Map
1qleD	1	0.1111	3.2	0.969	Contact Map
1m56D	1	0.1111	2.9	0.969	Contact Map
2bpsA	1	0.1691	2.6	0.97	Contact Map
4kq7A	4	0.3527	2.6	0.97	Contact Map
1fr3A	5	0.3237	2.5	0.971	Contact Map
4iucS	1	0.0242	2.1	0.972	Contact Map
2l8aA	1	0.6232	2.1	0.972	Contact Map
1pp5A	1	0.0918	2	0.972	Contact Map
3mmlB	1	0.2899	1.7	0.973	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.