Q9HQF3 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQF3 - Halocyanin-like

UniProt:	Q9HQF3	Sequences: MTDSDSAVTRRRVLQGSAGAGAAAAGIGGFAAGGAAQSASIDDWLGDVSNYDGVRDETGSSEVTVDVGVDANGGAYGFGPAAVRVDPGTTVTFEWVSNTHNVAVESQPDSADWGGVEEINNEGYTDSHTFETAGVYTYFCSPHRAMGMKGAVVVGDADVGGAASGGIDWGNLGVLGAGFALGIGLLMPFVRRALDPSPHNPNTHE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	205 (160)
Sequences:	259 (234)
Seq/√Len:	18.5

HALSA - Q9HQF3 Q9HRQ9 Q9HRS0 Q9HN93 Q9HRA6 Q9HR99

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
138_Y	150_G	3.865	1.00
93_F	152_V	3.638	1.00
33_G	37_Q	3.410	1.00
166_G	171_N	3.140	0.99
140_C	143_H	2.898	0.99
100_H	143_H	2.780	0.98
168_D	171_N	2.677	0.98
9_T	12_R	2.645	0.98
140_C	148_M	2.575	0.97
143_H	148_M	2.551	0.97
100_H	140_C	2.487	0.96
100_H	148_M	2.262	0.94
166_G	170_G	2.218	0.93
16_G	19_G	2.212	0.93
167_I	171_N	2.117	0.92
103_A	141_S	2.028	0.90
130_F	136_Y	2.026	0.90
15_Q	20_A	1.876	0.86
9_T	13_V	1.875	0.86
22_A	25_A	1.836	0.84
93_F	97_S	1.831	0.84
84_R	155_G	1.696	0.79
166_G	169_W	1.664	0.78
134_G	154_V	1.639	0.77
44_W	48_V	1.616	0.76
13_V	36_A	1.588	0.74
165_G	168_D	1.565	0.73
95_W	101_N	1.562	0.73
50_N	82_A	1.507	0.70
61_S	154_V	1.504	0.70
59_G	67_V	1.490	0.69
105_E	139_F	1.486	0.69
91_V	97_S	1.465	0.68
8_V	12_R	1.462	0.68
84_R	157_A	1.454	0.67
165_G	171_N	1.424	0.66
93_F	102_V	1.421	0.66
34_G	37_Q	1.407	0.65
164_S	167_I	1.399	0.64
91_V	130_F	1.351	0.62
20_A	25_A	1.345	0.61
41_I	48_V	1.335	0.61
71_A	77_G	1.326	0.60
165_G	169_W	1.296	0.58
28_G	82_A	1.292	0.58
15_Q	38_S	1.278	0.57
101_N	142_P	1.276	0.57
25_A	49_S	1.274	0.57
104_V	143_H	1.232	0.54
90_T	129_T	1.221	0.54
84_R	153_V	1.212	0.53
167_I	170_G	1.208	0.53
116_V	120_N	1.197	0.52
26_G	29_G	1.195	0.52
91_V	154_V	1.195	0.52
150_G	154_V	1.194	0.52
130_F	152_V	1.194	0.52
12_R	18_A	1.192	0.52
83_V	93_F	1.190	0.52
33_G	38_S	1.183	0.51
137_T	149_K	1.165	0.50
56_D	59_G	1.161	0.50
58_T	84_R	1.140	0.49
41_I	54_V	1.139	0.49
86_D	155_G	1.123	0.48
12_R	22_A	1.105	0.46
24_A	34_G	1.065	0.44
101_N	141_S	1.063	0.44
165_G	170_G	1.060	0.44
16_G	21_G	1.048	0.43
83_V	152_V	1.048	0.43
61_S	83_V	1.044	0.43
32_A	57_E	1.041	0.42
128_H	135_V	1.040	0.42
104_V	126_D	1.040	0.42
18_A	163_A	1.034	0.42
41_I	45_L	1.033	0.42
126_D	130_F	1.031	0.42
104_V	109_D	1.026	0.42
117_E	120_N	1.025	0.42
54_V	58_T	1.009	0.41
65_V	83_V	1.003	0.40
106_S	109_D	1.003	0.40
22_A	27_I	1.001	0.40
104_V	116_V	0.997	0.40
19_G	29_G	0.977	0.39
85_V	154_V	0.971	0.38
84_R	105_E	0.944	0.37
47_D	152_V	0.939	0.36
16_G	118_E	0.939	0.36
133_A	158_D	0.935	0.36
25_A	126_D	0.931	0.36
103_A	139_F	0.928	0.36
47_D	51_Y	0.922	0.35
127_S	152_V	0.915	0.35
22_A	37_Q	0.911	0.35
49_S	164_S	0.909	0.35
116_V	141_S	0.908	0.35
16_G	38_S	0.898	0.34
12_R	32_A	0.895	0.34
69_V	77_G	0.891	0.34
137_T	151_A	0.889	0.34
84_R	151_A	0.888	0.34
37_Q	40_S	0.883	0.33
68_G	95_W	0.880	0.33
13_V	39_A	0.872	0.33
113_W	126_D	0.864	0.32
21_G	30_F	0.863	0.32
31_A	36_A	0.861	0.32
61_S	89_T	0.856	0.32
75_A	146_M	0.852	0.32
90_T	127_S	0.852	0.32
76_Y	148_M	0.828	0.30
9_T	16_G	0.824	0.30
105_E	144_R	0.823	0.30
88_G	138_Y	0.823	0.30
94_E	99_T	0.810	0.29
14_L	24_A	0.807	0.29
65_V	87_P	0.802	0.29
142_P	148_M	0.800	0.29
51_Y	91_V	0.800	0.29
144_R	152_V	0.795	0.29
12_R	164_S	0.791	0.28
22_A	170_G	0.791	0.28
38_S	49_S	0.788	0.28
164_S	168_D	0.785	0.28
13_V	161_G	0.783	0.28
40_S	49_S	0.781	0.28
39_A	42_D	0.780	0.28
67_V	90_T	0.780	0.28
47_D	52_D	0.778	0.28
20_A	72_N	0.773	0.27
29_G	166_G	0.771	0.27
107_Q	113_W	0.769	0.27
31_A	127_S	0.765	0.27
104_V	148_M	0.763	0.27
161_G	164_S	0.762	0.27
139_F	149_K	0.761	0.27
42_D	53_G	0.760	0.27
41_I	51_Y	0.758	0.27
29_G	32_A	0.758	0.27
45_L	72_N	0.755	0.27
17_S	21_G	0.747	0.26
22_A	51_Y	0.745	0.26
45_L	51_Y	0.743	0.26
31_A	35_A	0.743	0.26
14_L	17_S	0.735	0.26
120_N	149_K	0.724	0.25
76_Y	142_P	0.723	0.25
135_V	141_S	0.722	0.25
56_D	63_V	0.715	0.25
42_D	46_G	0.710	0.24
33_G	36_A	0.709	0.24
59_G	122_E	0.704	0.24
107_Q	136_Y	0.703	0.24
12_R	15_Q	0.703	0.24
62_E	89_T	0.690	0.24
19_G	62_E	0.688	0.23
105_E	155_G	0.683	0.23
98_N	116_V	0.674	0.23
108_P	156_D	0.672	0.23
104_V	108_P	0.668	0.23
114_G	124_Y	0.667	0.23
117_E	128_H	0.667	0.23
137_T	143_H	0.666	0.22
102_V	127_S	0.665	0.22
13_V	20_A	0.660	0.22
17_S	26_G	0.658	0.22
93_F	138_Y	0.656	0.22
76_Y	146_M	0.652	0.22
100_H	146_M	0.649	0.22
43_D	47_D	0.645	0.22
103_A	106_S	0.643	0.21
106_S	135_V	0.640	0.21
26_G	90_T	0.639	0.21
9_T	17_S	0.636	0.21
28_G	162_A	0.635	0.21
101_N	145_A	0.631	0.21
25_A	62_E	0.628	0.21
16_G	22_A	0.625	0.21
29_G	157_A	0.623	0.21
76_Y	153_V	0.620	0.21
146_M	152_V	0.617	0.20
75_A	79_G	0.615	0.20
28_G	31_A	0.609	0.20
93_F	104_V	0.607	0.20
77_G	139_F	0.606	0.20
109_D	113_W	0.600	0.20
16_G	78_F	0.598	0.20
107_Q	132_T	0.596	0.20
55_R	153_V	0.596	0.20
121_N	125_T	0.595	0.20
76_Y	84_R	0.590	0.19
79_G	83_V	0.590	0.19
24_A	52_D	0.589	0.19
40_S	44_W	0.589	0.19
64_T	94_E	0.589	0.19
14_L	27_I	0.578	0.19
90_T	144_R	0.576	0.19
25_A	32_A	0.576	0.19
106_S	137_T	0.574	0.19
129_T	132_T	0.570	0.19
100_H	104_V	0.569	0.19
17_S	28_G	0.568	0.18
134_G	138_Y	0.562	0.18
104_V	140_C	0.561	0.18
34_G	83_V	0.559	0.18
18_A	154_V	0.556	0.18
40_S	43_D	0.556	0.18
65_V	133_A	0.554	0.18
26_G	124_Y	0.547	0.18
44_W	50_N	0.547	0.18
46_G	53_G	0.546	0.18
156_D	159_V	0.546	0.18
18_A	156_D	0.542	0.18
40_S	45_L	0.542	0.18
163_A	166_G	0.541	0.17
109_D	136_Y	0.535	0.17
161_G	169_W	0.533	0.17
128_H	136_Y	0.533	0.17
51_Y	92_T	0.533	0.17
116_V	119_I	0.532	0.17
18_A	28_G	0.532	0.17
130_F	145_A	0.525	0.17
91_V	95_W	0.525	0.17
95_W	120_N	0.525	0.17
120_N	124_Y	0.522	0.17
113_W	148_M	0.515	0.17
134_G	150_G	0.513	0.17
121_N	124_Y	0.511	0.16
136_Y	146_M	0.509	0.16
76_Y	101_N	0.508	0.16
117_E	144_R	0.506	0.16
11_R	27_I	0.505	0.16
41_I	46_G	0.504	0.16
40_S	91_V	0.502	0.16
139_F	156_D	0.502	0.16
164_S	170_G	0.502	0.16
59_G	63_V	0.501	0.16
34_G	38_S	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3c75A	1	0.5122	99.9	0.585	Contact Map
3ef4A	1	0.6	99.8	0.635	Contact Map
5akrA	3	0.7463	99.8	0.641	Contact Map
3erxA	3	0.5951	99.8	0.643	Contact Map
3cvbA	1	0.4585	99.8	0.647	Contact Map
1iuzA	1	0.4488	99.8	0.65	Contact Map
1pcsA	2	0.4537	99.8	0.651	Contact Map
1pmyA	1	0.5951	99.8	0.651	Contact Map
3tu6A	1	0.6146	99.8	0.651	Contact Map
1pazA	1	0.5805	99.8	0.653	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.