Q9HQE6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQE6 - Bacterioferritin comigrating protein

UniProt:	Q9HQE6	Sequences: MLSEGTTAPDFSLANQDDETVSLSSFAGQHVVVYFYPRADTPGCTSEACEFRDNWGRYDDAGVPVVGISDDPVSELAAFKDKYNLPFDLLSDAGGEVATAYESYDEQEITGELMDVTLRNTYVIGPDGTITAAFEGVDPEGHADEVLAAIEDAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	154 (141)
Sequences:	11554 (6992)
Seq/√Len:	588.8

ECOLI - AHPC BCP TPX DSBE
BACSU - AHPC BCP YKUU TPX RESA YKUV STOA YNEN
HALSA - Q9HQE6 Q9HP28 Q9HN00 Q9HRG4
SULSO - Q97VL0 Q97WG5 Q97WP9 TDXH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_H	126_P	3.276	1.00
12_S	20_T	2.861	1.00
61_A	151_E	2.840	1.00
39_A	76_L	2.650	1.00
52_R	86_P	2.603	1.00
8_A	101_Y	2.439	1.00
12_S	22_S	2.366	1.00
29_Q	64_P	2.345	1.00
125_G	131_T	2.333	1.00
55_W	59_D	2.256	1.00
14_A	20_T	2.195	1.00
15_N	19_E	2.144	1.00
7_T	129_T	2.120	1.00
105_D	118_L	2.065	1.00
54_N	57_R	1.958	1.00
10_D	24_S	1.951	1.00
16_Q	80_K	1.852	1.00
22_S	25_S	1.825	1.00
125_G	129_T	1.803	1.00
55_W	86_P	1.760	1.00
10_D	22_S	1.695	1.00
70_D	95_G	1.666	1.00
132_A	149_A	1.655	1.00
96_E	100_A	1.632	1.00
13_L	90_L	1.629	1.00
21_V	26_F	1.610	1.00
13_L	97_V	1.608	1.00
48_A	85_L	1.608	1.00
70_D	98_A	1.581	1.00
63_V	150_I	1.464	1.00
40_D	83_Y	1.438	1.00
15_N	21_V	1.437	1.00
54_N	143_A	1.423	1.00
59_D	64_P	1.360	1.00
40_D	78_A	1.337	1.00
15_N	88_D	1.319	1.00
52_R	87_F	1.298	1.00
32_V	123_V	1.288	1.00
26_F	66_V	1.285	1.00
77_A	81_D	1.280	1.00
98_A	117_T	1.275	1.00
95_G	99_T	1.248	1.00
124_I	130_I	1.245	1.00
31_V	64_P	1.237	1.00
26_F	31_V	1.234	1.00
31_V	66_V	1.187	1.00
30_H	63_V	1.182	1.00
134_F	149_A	1.174	1.00
144_D	148_A	1.167	1.00
70_D	117_T	1.167	1.00
27_A	31_V	1.160	1.00
35_F	68_I	1.157	1.00
67_G	89_L	1.143	1.00
56_G	59_D	1.138	1.00
57_R	60_D	1.133	1.00
4_E	132_A	1.126	1.00
49_C	53_D	1.114	1.00
30_H	131_T	1.112	1.00
54_N	144_D	1.111	1.00
145_E	148_A	1.111	1.00
14_A	73_V	1.104	1.00
106_E	115_D	1.096	1.00
97_V	101_Y	1.082	1.00
50_E	54_N	1.072	1.00
34_Y	48_A	1.070	1.00
40_D	82_K	1.060	1.00
27_A	128_G	1.042	1.00
103_S	120_N	1.026	1.00
99_T	115_D	1.022	1.00
49_C	52_R	1.013	1.00
57_R	147_L	1.012	1.00
123_V	149_A	1.007	1.00
8_A	124_I	1.005	1.00
74_S	78_A	1.001	1.00
46_S	140_E	0.993	1.00
11_F	101_Y	0.985	1.00
51_F	65_V	0.982	1.00
32_V	121_T	0.973	1.00
95_G	104_Y	0.950	1.00
8_A	130_I	0.946	1.00
148_A	151_E	0.944	1.00
31_V	128_G	0.943	1.00
40_D	75_E	0.936	1.00
64_P	88_D	0.923	1.00
57_R	151_E	0.922	1.00
15_N	90_L	0.920	1.00
78_A	81_D	0.918	1.00
141_G	144_D	0.915	1.00
23_L	31_V	0.915	1.00
56_G	60_D	0.915	1.00
50_E	53_D	0.912	1.00
103_S	122_Y	0.910	1.00
7_T	27_A	0.902	1.00
99_T	104_Y	0.899	1.00
17_D	77_A	0.899	1.00
11_F	97_V	0.897	1.00
24_S	27_A	0.889	1.00
77_A	80_K	0.889	1.00
34_Y	87_F	0.884	1.00
72_P	75_E	0.879	1.00
66_V	90_L	0.868	1.00
96_E	99_T	0.858	1.00
122_Y	130_I	0.855	1.00
95_G	98_A	0.855	1.00
31_V	124_I	0.847	1.00
33_V	124_I	0.846	1.00
73_V	91_S	0.844	1.00
15_N	18_D	0.843	1.00
123_V	132_A	0.841	1.00
30_H	62_G	0.837	1.00
147_L	151_E	0.831	1.00
10_D	23_L	0.830	1.00
68_I	97_V	0.823	1.00
105_D	114_M	0.818	1.00
118_L	136_G	0.814	1.00
32_V	63_V	0.812	1.00
45_T	83_Y	0.811	1.00
4_E	133_A	0.810	1.00
21_V	66_V	0.810	1.00
46_S	49_C	0.784	1.00
62_G	126_P	0.772	1.00
52_R	55_W	0.761	1.00
132_A	145_E	0.760	1.00
120_N	133_A	0.755	1.00
98_A	104_Y	0.754	1.00
49_C	83_Y	0.753	1.00
131_T	136_G	0.744	1.00
138_D	141_G	0.742	1.00
123_V	134_F	0.742	1.00
16_Q	88_D	0.737	1.00
104_Y	115_D	0.734	1.00
41_T	119_R	0.731	1.00
14_A	93_A	0.729	1.00
134_F	146_V	0.726	1.00
47_E	121_T	0.723	1.00
141_G	145_E	0.719	1.00
30_H	150_I	0.718	1.00
56_G	86_P	0.707	1.00
28_G	126_P	0.703	1.00
52_R	56_G	0.702	1.00
37_P	41_T	0.701	1.00
4_E	130_I	0.700	1.00
17_D	80_K	0.697	1.00
33_V	101_Y	0.696	1.00
73_V	77_A	0.695	1.00
8_A	23_L	0.690	1.00
79_F	83_Y	0.688	1.00
58_Y	147_L	0.686	1.00
51_F	146_V	0.683	1.00
74_S	77_A	0.680	1.00
38_R	71_D	0.677	1.00
23_L	26_F	0.677	1.00
26_F	64_P	0.672	1.00
36_Y	39_A	0.665	1.00
32_V	51_F	0.664	1.00
121_T	146_V	0.660	1.00
6_T	133_A	0.659	1.00
80_K	89_L	0.659	1.00
38_R	116_V	0.657	1.00
16_Q	77_A	0.650	1.00
57_R	61_A	0.647	1.00
34_Y	47_E	0.644	1.00
61_A	150_I	0.641	1.00
47_E	51_F	0.640	1.00
50_E	143_A	0.640	1.00
76_L	79_F	0.639	1.00
35_F	103_S	0.635	1.00
32_V	146_V	0.634	1.00
54_N	58_Y	0.631	1.00
30_H	123_V	0.630	1.00
9_P	100_A	0.628	1.00
118_L	135_E	0.623	1.00
39_A	75_E	0.622	1.00
72_P	93_A	0.621	1.00
8_A	97_V	0.619	1.00
66_V	88_D	0.610	1.00
105_D	116_V	0.609	1.00
122_Y	133_A	0.604	1.00
61_A	147_L	0.597	1.00
48_A	67_G	0.595	1.00
97_V	100_A	0.591	1.00
55_W	64_P	0.590	1.00
36_Y	67_G	0.582	1.00
10_D	27_A	0.579	1.00
134_F	145_E	0.573	1.00
35_F	101_Y	0.569	1.00
58_Y	63_V	0.567	1.00
36_Y	79_F	0.563	1.00
92_D	95_G	0.561	0.99
42_P	45_T	0.558	0.99
75_E	78_A	0.557	0.99
51_F	143_A	0.552	0.99
7_T	10_D	0.548	0.99
105_D	115_D	0.541	0.99
16_Q	73_V	0.538	0.99
38_R	41_T	0.535	0.99
55_W	65_V	0.534	0.99
21_V	25_S	0.530	0.99
34_Y	43_G	0.530	0.99
35_F	97_V	0.529	0.99
37_P	119_R	0.527	0.99
124_I	128_G	0.527	0.99
76_L	91_S	0.527	0.99
34_Y	51_F	0.512	0.99
98_A	103_S	0.512	0.99
34_Y	67_G	0.510	0.99
38_R	72_P	0.510	0.99
71_D	75_E	0.508	0.99
32_V	150_I	0.504	0.99
18_D	73_V	0.500	0.99
136_G	140_E	0.500	0.99
114_M	118_L	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2v2gA	2	0.9935	100	0.254	Contact Map
1prxA	2	0.9935	100	0.266	Contact Map
3w6gA	6	0.9481	100	0.27	Contact Map
3a2vA	5	0.961	100	0.273	Contact Map
1xccA	2	0.9935	100	0.274	Contact Map
1xiyA	1	0.974	100	0.293	Contact Map
1xvwA	3	0.961	100	0.31	Contact Map
3ixrA	1	0.987	100	0.312	Contact Map
2c0dA	2	0.9416	100	0.325	Contact Map
3tjjA	3	0.961	100	0.33	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.