Q9HQE2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQE2 - Uncharacterized protein

UniProt:	Q9HQE2	Sequences: MSHEAVFVDLDNTLYPYQPCNEAGQQAAWETATDRGYDVSRAAFESLYSRARAAVKREVSETASAHDRGLYFKRAIELQAGTPNAADALALADAYWDAYIDALSLFDGVRETLDRLRDAGLDVAVVTNLTTRVQLRKLAATGLADRVDCVLTSQEVGREKPASVMFTVPLARLGVAPADAVMVGDSVASDVVGANGVGLTSVLCNNDRTGLTGRESPDHRIESFRDVTDVVL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	232 (206)
Sequences:	29512 (23213)
Seq/√Len:	1617.3

ECOLI - YJJG YNIC YFBT YRFG GPH YIGB YIEH PGMB YQAB YIHX
BACSU - YSAA YHCW PPAX YFNB PGMB
HALSA - Q9HQE2 Q9HSS2 Q9HP74 Q9HMC4
SULSO - Q7LXL6 Q7LX46 Q97ZU6 Q97WT6 Q97X58 Q97YZ1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_E	179_D	4.084	1.00
139_A	144_A	2.785	1.00
168_V	172_R	2.779	1.00
158_R	162_A	2.730	1.00
184_G	190_D	2.624	1.00
194_A	201_S	2.564	1.00
131_T	135_L	2.503	1.00
5_A	175_V	2.418	1.00
114_D	146_R	2.340	1.00
110_R	114_D	2.310	1.00
3_H	200_T	2.252	1.00
168_V	171_A	2.226	1.00
122_D	148_D	2.211	1.00
124_A	149_C	2.195	1.00
131_T	155_E	2.157	1.00
126_V	165_M	2.151	1.00
127_T	134_Q	2.115	1.00
158_R	164_V	2.097	1.00
170_L	180_A	2.067	1.00
8_V	123_V	2.053	1.00
222_E	226_D	2.012	1.00
191_V	201_S	2.007	1.00
195_N	218_D	1.984	1.00
149_C	172_R	1.984	1.00
176_A	179_D	1.902	1.00
115_R	119_A	1.870	1.00
192_V	196_G	1.856	1.00
200_T	218_D	1.774	1.00
6_V	121_L	1.767	1.00
117_R	146_R	1.747	1.00
170_L	199_L	1.700	1.00
7_F	182_M	1.684	1.00
117_R	148_D	1.655	1.00
182_M	194_A	1.645	1.00
181_V	202_V	1.605	1.00
109_V	224_F	1.580	1.00
170_L	177_P	1.551	1.00
123_V	147_V	1.549	1.00
7_F	169_P	1.519	1.00
40_S	43_A	1.518	1.00
5_A	173_L	1.505	1.00
7_F	126_V	1.498	1.00
205_N	222_E	1.497	1.00
92_A	96_W	1.472	1.00
106_F	206_N	1.427	1.00
175_V	180_A	1.423	1.00
124_A	173_L	1.404	1.00
6_V	116_L	1.384	1.00
6_V	183_V	1.381	1.00
135_L	144_A	1.381	1.00
112_T	224_F	1.368	1.00
202_V	221_I	1.354	1.00
205_N	220_R	1.333	1.00
27_A	31_T	1.283	1.00
10_L	15_Y	1.279	1.00
223_S	226_D	1.278	1.00
202_V	219_H	1.274	1.00
187_V	192_V	1.268	1.00
10_L	125_V	1.267	1.00
13_T	183_V	1.263	1.00
115_R	118_D	1.259	1.00
90_A	94_A	1.250	1.00
14_L	109_V	1.249	1.00
94_A	98_A	1.244	1.00
91_L	95_Y	1.241	1.00
31_T	94_A	1.237	1.00
163_S	167_T	1.229	1.00
3_H	181_V	1.227	1.00
135_L	139_A	1.210	1.00
70_L	73_K	1.206	1.00
108_G	111_E	1.184	1.00
87_D	91_L	1.175	1.00
151_L	172_R	1.169	1.00
10_L	134_Q	1.156	1.00
7_F	180_A	1.147	1.00
89_L	93_D	1.141	1.00
166_F	193_G	1.140	1.00
84_N	87_D	1.137	1.00
30_E	38_D	1.131	1.00
151_L	169_P	1.130	1.00
28_A	32_A	1.129	1.00
31_T	90_A	1.125	1.00
134_Q	152_T	1.122	1.00
166_F	182_M	1.117	1.00
105_L	143_L	1.116	1.00
5_A	180_A	1.103	1.00
27_A	94_A	1.096	1.00
94_A	97_D	1.093	1.00
111_E	225_R	1.091	1.00
47_L	50_R	1.083	1.00
11_D	17_Y	1.080	1.00
27_A	30_E	1.070	1.00
180_A	199_L	1.060	1.00
87_D	90_A	1.057	1.00
166_F	199_L	1.038	1.00
23_A	27_A	1.032	1.00
125_V	147_V	1.032	1.00
70_L	74_R	1.026	1.00
117_R	123_V	1.023	1.00
86_A	90_A	1.023	1.00
5_A	122_D	1.022	1.00
114_D	118_D	1.020	1.00
92_A	95_Y	1.016	1.00
167_T	171_A	1.014	1.00
95_Y	99_Y	1.010	1.00
27_A	98_A	1.008	1.00
142_G	145_D	1.005	1.00
113_L	147_V	1.005	1.00
126_V	169_P	1.003	1.00
10_L	129_L	0.998	1.00
77_E	80_A	0.996	1.00
49_S	52_R	0.981	1.00
195_N	201_S	0.976	1.00
167_T	197_V	0.970	1.00
164_V	168_V	0.969	1.00
164_V	167_T	0.966	1.00
149_C	173_L	0.964	1.00
110_R	146_R	0.963	1.00
136_R	140_A	0.962	1.00
182_M	199_L	0.956	1.00
169_P	173_L	0.950	1.00
131_T	152_T	0.946	1.00
88_A	92_A	0.935	1.00
26_Q	41_R	0.933	1.00
23_A	26_Q	0.933	1.00
32_A	90_A	0.928	1.00
131_T	154_Q	0.927	1.00
156_V	168_V	0.925	1.00
136_R	139_A	0.921	1.00
114_D	145_D	0.918	1.00
26_Q	30_E	0.918	1.00
45_E	48_Y	0.916	1.00
191_V	217_P	0.915	1.00
166_F	184_G	0.914	1.00
88_A	91_L	0.913	1.00
80_A	83_P	0.908	1.00
5_A	124_A	0.907	1.00
76_I	79_Q	0.904	1.00
74_R	77_E	0.903	1.00
167_T	177_P	0.898	1.00
189_S	192_V	0.888	1.00
90_A	93_D	0.886	1.00
73_K	77_E	0.885	1.00
111_E	114_D	0.882	1.00
69_G	73_K	0.879	1.00
105_L	110_R	0.878	1.00
195_N	216_S	0.878	1.00
23_A	102_A	0.873	1.00
11_D	129_L	0.869	1.00
200_T	219_H	0.868	1.00
7_F	199_L	0.866	1.00
11_D	127_T	0.863	1.00
42_A	46_S	0.861	1.00
127_T	152_T	0.860	1.00
7_F	173_L	0.859	1.00
183_V	202_V	0.858	1.00
193_G	197_V	0.857	1.00
108_G	223_S	0.850	1.00
177_P	199_L	0.847	1.00
134_Q	137_K	0.845	1.00
93_D	97_D	0.835	1.00
151_L	168_V	0.832	1.00
181_V	200_T	0.831	1.00
124_A	169_P	0.830	1.00
106_F	204_C	0.830	1.00
43_A	46_S	0.814	1.00
221_I	227_V	0.812	1.00
203_L	220_R	0.807	1.00
113_L	146_R	0.801	1.00
89_L	92_A	0.797	1.00
116_L	121_L	0.797	1.00
106_F	109_V	0.796	1.00
157_G	164_V	0.795	1.00
201_S	218_D	0.795	1.00
15_Y	137_K	0.786	1.00
129_L	134_Q	0.784	1.00
116_L	123_V	0.779	1.00
186_S	189_S	0.779	1.00
15_Y	141_T	0.777	1.00
10_L	137_K	0.775	1.00
108_G	225_R	0.774	1.00
6_V	181_V	0.773	1.00
4_E	121_L	0.765	1.00
22_E	26_Q	0.760	1.00
123_V	146_R	0.760	1.00
85_A	89_L	0.759	1.00
183_V	227_V	0.758	1.00
48_Y	52_R	0.752	1.00
98_A	101_D	0.739	1.00
191_V	203_L	0.737	1.00
110_R	145_D	0.736	1.00
43_A	47_L	0.735	1.00
110_R	142_G	0.735	1.00
175_V	179_D	0.731	1.00
21_N	25_Q	0.729	1.00
41_R	45_E	0.724	1.00
128_N	159_E	0.723	1.00
105_L	141_T	0.723	1.00
24_G	28_A	0.719	1.00
11_D	185_D	0.718	1.00
202_V	227_V	0.718	1.00
4_E	122_D	0.717	1.00
74_R	78_L	0.715	1.00
68_R	71_Y	0.711	1.00
206_N	224_F	0.709	1.00
111_E	115_R	0.708	1.00
182_M	190_D	0.707	1.00
91_L	94_A	0.707	1.00
47_L	51_A	0.706	1.00
13_T	190_D	0.700	1.00
152_T	155_E	0.698	1.00
134_Q	150_V	0.695	1.00
3_H	121_L	0.688	1.00
165_M	169_P	0.688	1.00
3_H	179_D	0.688	1.00
7_F	124_A	0.686	1.00
138_L	144_A	0.684	1.00
166_F	190_D	0.676	1.00
155_E	172_R	0.674	1.00
31_T	91_L	0.673	1.00
4_E	175_V	0.672	1.00
21_N	129_L	0.672	1.00
122_D	175_V	0.671	1.00
212_T	216_S	0.668	1.00
212_T	215_E	0.668	1.00
163_S	196_G	0.668	1.00
204_C	224_F	0.667	1.00
68_R	72_F	0.667	1.00
221_I	224_F	0.666	1.00
149_C	169_P	0.666	1.00
177_P	180_A	0.664	1.00
192_V	195_N	0.664	1.00
19_P	104_S	0.664	1.00
39_V	44_F	0.661	1.00
12_N	18_Q	0.660	1.00
20_C	103_L	0.656	1.00
123_V	148_D	0.655	1.00
128_N	161_P	0.649	1.00
42_A	45_E	0.649	1.00
16_P	104_S	0.648	1.00
165_M	193_G	0.646	1.00
128_N	189_S	0.642	1.00
33_T	37_Y	0.635	1.00
88_A	95_Y	0.631	1.00
156_V	165_M	0.630	1.00
112_T	183_V	0.627	1.00
108_G	112_T	0.625	1.00
182_M	193_G	0.622	1.00
71_Y	75_A	0.621	1.00
126_V	182_M	0.620	1.00
151_L	165_M	0.618	1.00
15_Y	103_L	0.618	1.00
48_Y	51_A	0.614	1.00
135_L	150_V	0.612	1.00
17_Y	129_L	0.609	1.00
91_L	96_W	0.608	1.00
11_D	137_K	0.607	1.00
147_V	150_V	0.606	1.00
69_G	85_A	0.602	1.00
109_V	113_L	0.595	1.00
100_I	136_R	0.591	1.00
153_S	165_M	0.585	1.00
72_F	75_A	0.585	1.00
44_F	47_L	0.585	1.00
170_L	175_V	0.583	1.00
16_P	19_P	0.581	1.00
170_L	197_V	0.576	1.00
13_T	204_C	0.576	1.00
134_Q	138_L	0.573	1.00
16_P	106_F	0.573	1.00
189_S	193_G	0.571	1.00
210_G	213_G	0.571	1.00
71_Y	74_R	0.570	1.00
86_A	89_L	0.569	1.00
117_R	145_D	0.567	1.00
8_V	112_T	0.563	1.00
114_D	117_R	0.563	1.00
203_L	212_T	0.562	1.00
167_T	170_L	0.559	1.00
108_G	206_N	0.556	1.00
100_I	140_A	0.554	1.00
109_V	112_T	0.550	1.00
7_F	166_F	0.542	1.00
129_L	184_G	0.539	1.00
149_C	152_T	0.537	1.00
39_V	43_A	0.536	1.00
72_F	76_I	0.535	1.00
125_V	138_L	0.533	1.00
107_D	225_R	0.530	1.00
105_L	109_V	0.528	1.00
139_A	145_D	0.528	1.00
45_E	52_R	0.527	1.00
22_E	44_F	0.525	1.00
129_L	133_V	0.524	1.00
112_T	115_R	0.522	1.00
14_L	125_V	0.521	1.00
76_I	81_G	0.520	1.00
203_L	217_P	0.520	1.00
6_V	123_V	0.520	1.00
192_V	215_E	0.518	1.00
19_P	23_A	0.517	1.00
45_E	49_S	0.515	1.00
126_V	151_L	0.515	1.00
132_R	136_R	0.513	1.00
112_T	116_L	0.512	1.00
87_D	94_A	0.506	1.00
46_S	50_R	0.505	1.00
151_L	173_L	0.504	1.00
30_E	33_T	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4eekA	2	0.9138	100	0.281	Contact Map
4uw9A	1	0.8578	100	0.288	Contact Map
3l5kA	1	0.9138	100	0.289	Contact Map
3qnmA	1	0.9741	100	0.294	Contact Map
1swvA	2	0.9526	100	0.298	Contact Map
2om6A	2	0.9655	100	0.298	Contact Map
2hdoA	1	0.8836	100	0.3	Contact Map
2zg6A	2	0.8621	100	0.301	Contact Map
3qxgA	3	0.9095	100	0.301	Contact Map
3ed5A	1	0.9655	100	0.302	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.