Q9HQD9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQD9 - Uncharacterized protein

UniProt:	Q9HQD9	Sequences: MQQATLRLAGSGSAYAAATANTDARMQLWCNDHCDLLEVSGGGVARVLAAVDARVGIRDRVTEGDTTVAVTEACLRAATADGVEDTLAAHGCLLVPPLTYDDGQKHLQVLALSPAALTDVYHALRADYEITVADKREVSAPASAAPGTQAADLTARQAAVLRAAVDAGYYERPRETTTAALADRFDIARSTLEEHLRRAEGKLARAAVRD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	210 (197)
Sequences:	1864 (1481)
Seq/√Len:	105.5

HALSA - Q9HQD9 Q9HSM9 O54637 Q9HSR5 Q9HR58 Q9HPS7 DMSR Q9HQU9
SULSO - Q97YL7 Q97WR0 Q97YT8 Q97UD7 Q97ZB6 Q97X87 Q97Y14 Q7LXI8 Q97UC0 Q97ZX5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
170_Y	200_E	4.321	1.00
176_T	181_L	4.088	1.00
163_A	167_A	3.827	1.00
160_V	185_F	3.461	1.00
167_A	181_L	3.294	1.00
188_A	191_T	3.133	1.00
87_L	92_C	3.071	1.00
167_A	184_R	2.985	1.00
191_T	195_H	2.974	1.00
171_E	175_E	2.902	1.00
156_R	195_H	2.872	1.00
176_T	180_A	2.837	1.00
92_C	111_A	2.820	1.00
177_T	180_A	2.764	1.00
165_V	205_R	2.714	1.00
19_T	103_G	2.509	1.00
163_A	181_L	2.457	1.00
178_T	192_L	2.249	1.00
156_R	160_V	2.202	1.00
158_A	162_R	2.086	1.00
172_R	193_E	2.037	1.00
156_R	159_A	1.961	1.00
187_I	192_L	1.955	1.00
63_E	68_V	1.901	1.00
195_H	198_R	1.892	1.00
32_D	35_D	1.870	1.00
161_L	204_A	1.828	1.00
7_R	104_Q	1.820	1.00
57_I	60_R	1.767	1.00
63_E	69_A	1.741	1.00
95_V	110_L	1.711	1.00
160_V	195_H	1.692	1.00
6_L	109_V	1.663	1.00
178_T	193_E	1.651	1.00
189_R	193_E	1.619	1.00
181_L	192_L	1.565	1.00
174_R	197_R	1.528	1.00
195_H	202_K	1.467	1.00
204_A	207_A	1.405	1.00
44_V	47_V	1.400	1.00
63_E	71_T	1.385	1.00
113_S	116_A	1.353	1.00
119_D	122_H	1.350	0.99
203_L	207_A	1.337	0.99
160_V	187_I	1.335	0.99
124_L	128_Y	1.328	0.99
28_L	31_N	1.319	0.99
172_R	194_E	1.282	0.99
169_Y	174_R	1.270	0.99
63_E	70_V	1.270	0.99
4_A	10_G	1.261	0.99
180_A	183_D	1.258	0.99
7_R	131_T	1.258	0.99
70_V	73_A	1.245	0.99
178_T	195_H	1.238	0.99
176_T	184_R	1.230	0.99
44_V	48_L	1.225	0.99
165_V	208_V	1.225	0.99
85_D	89_A	1.225	0.99
15_Y	18_A	1.221	0.99
161_L	170_Y	1.220	0.99
182_A	192_L	1.216	0.99
190_S	194_E	1.208	0.99
17_A	22_T	1.204	0.99
169_Y	178_T	1.197	0.99
191_T	196_L	1.194	0.99
121_Y	130_I	1.184	0.99
168_G	175_E	1.174	0.99
201_G	205_R	1.131	0.98
196_L	200_E	1.125	0.98
160_V	199_A	1.124	0.98
15_Y	19_T	1.123	0.98
48_L	70_V	1.122	0.98
162_R	166_D	1.115	0.98
51_V	60_R	1.113	0.98
170_Y	196_L	1.110	0.98
160_V	181_L	1.106	0.98
165_V	170_Y	1.106	0.98
65_D	68_V	1.101	0.98
38_E	69_A	1.094	0.98
194_E	198_R	1.082	0.98
153_L	199_A	1.078	0.98
183_D	186_D	1.075	0.97
191_T	194_E	1.068	0.97
7_R	133_A	1.067	0.97
159_A	162_R	1.062	0.97
172_R	197_R	1.057	0.97
26_M	198_R	1.050	0.97
172_R	190_S	1.043	0.97
170_Y	199_A	1.043	0.97
150_A	207_A	1.036	0.97
37_L	94_L	1.030	0.97
17_A	54_R	1.027	0.97
116_A	119_D	1.023	0.97
160_V	192_L	1.018	0.96
97_P	170_Y	1.013	0.96
62_T	69_A	0.989	0.96
111_A	131_T	0.987	0.96
203_L	206_A	0.986	0.96
110_L	170_Y	0.979	0.96
94_L	109_V	0.959	0.95
179_A	189_R	0.950	0.95
6_L	121_Y	0.949	0.95
106_H	133_A	0.947	0.95
82_G	85_D	0.946	0.95
61_V	176_T	0.940	0.95
68_V	71_T	0.939	0.94
4_A	117_L	0.937	0.94
91_G	113_S	0.935	0.94
161_L	208_V	0.933	0.94
167_A	176_T	0.932	0.94
62_T	67_T	0.929	0.94
152_D	206_A	0.928	0.94
43_G	46_R	0.924	0.94
62_T	70_V	0.922	0.94
189_R	198_R	0.920	0.94
44_V	68_V	0.914	0.94
132_V	135_K	0.910	0.94
135_K	169_Y	0.907	0.93
188_A	197_R	0.903	0.93
178_T	189_R	0.883	0.92
33_H	98_L	0.872	0.92
165_V	204_A	0.872	0.92
32_D	183_D	0.871	0.92
181_L	185_F	0.863	0.92
28_L	37_L	0.861	0.91
29_W	38_E	0.859	0.91
191_T	199_A	0.858	0.91
143_S	151_A	0.854	0.91
63_E	73_A	0.848	0.91
170_Y	178_T	0.843	0.91
178_T	191_T	0.841	0.91
156_R	194_E	0.835	0.90
49_A	85_D	0.834	0.90
17_A	21_N	0.832	0.90
172_R	201_G	0.827	0.90
90_H	123_A	0.827	0.90
91_G	123_A	0.824	0.90
163_A	184_R	0.818	0.89
120_V	194_E	0.813	0.89
58_R	61_V	0.810	0.89
46_R	49_A	0.810	0.89
111_A	170_Y	0.805	0.89
162_R	208_V	0.802	0.88
46_R	66_T	0.795	0.88
167_A	192_L	0.795	0.88
121_Y	191_T	0.795	0.88
172_R	179_A	0.794	0.88
185_F	192_L	0.787	0.87
88_A	181_L	0.783	0.87
40_S	46_R	0.783	0.87
99_T	106_H	0.770	0.86
28_L	114_P	0.770	0.86
118_T	121_Y	0.769	0.86
81_D	170_Y	0.768	0.86
73_A	170_Y	0.767	0.86
19_T	102_D	0.767	0.86
171_E	201_G	0.760	0.85
54_R	57_I	0.758	0.85
26_M	39_V	0.754	0.85
19_T	22_T	0.752	0.85
140_A	171_E	0.749	0.85
94_L	119_D	0.745	0.84
179_A	197_R	0.725	0.83
134_D	181_L	0.720	0.82
122_H	126_A	0.719	0.82
159_A	163_A	0.714	0.82
37_L	72_E	0.711	0.81
39_V	47_V	0.704	0.81
117_L	159_A	0.701	0.81
46_R	50_A	0.696	0.80
186_D	194_E	0.692	0.80
57_I	74_C	0.688	0.79
69_A	73_A	0.688	0.79
56_G	95_V	0.683	0.79
10_G	13_S	0.680	0.79
156_R	200_E	0.678	0.78
135_K	190_S	0.676	0.78
47_V	68_V	0.676	0.78
97_P	200_E	0.675	0.78
72_E	94_L	0.671	0.78
198_R	201_G	0.670	0.78
45_A	48_L	0.669	0.77
63_E	76_R	0.668	0.77
112_L	125_R	0.667	0.77
12_G	77_A	0.667	0.77
27_Q	30_C	0.666	0.77
174_R	203_L	0.666	0.77
20_A	82_G	0.658	0.76
199_A	204_A	0.657	0.76
47_V	175_E	0.655	0.76
131_T	139_S	0.655	0.76
46_R	67_T	0.655	0.76
103_G	126_A	0.655	0.76
48_L	60_R	0.654	0.76
198_R	203_L	0.652	0.76
143_S	155_A	0.652	0.76
30_C	74_C	0.651	0.75
172_R	195_H	0.649	0.75
92_C	141_P	0.646	0.75
87_L	107_L	0.646	0.75
152_D	205_R	0.646	0.75
161_L	199_A	0.643	0.75
6_L	9_A	0.639	0.74
98_L	107_L	0.634	0.74
100_Y	105_K	0.634	0.74
69_A	190_S	0.634	0.74
163_A	185_F	0.634	0.74
73_A	76_R	0.633	0.73
94_L	150_A	0.627	0.73
118_T	191_T	0.626	0.73
92_C	97_P	0.619	0.72
86_T	127_D	0.618	0.72
150_A	160_V	0.614	0.71
88_A	140_A	0.614	0.71
191_T	198_R	0.613	0.71
45_A	49_A	0.610	0.71
23_D	77_A	0.609	0.71
90_H	154_T	0.608	0.70
132_V	187_I	0.607	0.70
28_L	110_L	0.604	0.70
38_E	41_G	0.604	0.70
168_G	171_E	0.603	0.70
204_A	208_V	0.601	0.70
187_I	195_H	0.601	0.70
168_G	193_E	0.599	0.69
64_G	199_A	0.599	0.69
77_A	131_T	0.597	0.69
17_A	20_A	0.596	0.69
20_A	166_D	0.595	0.69
176_T	192_L	0.594	0.69
16_A	19_T	0.594	0.69
113_S	158_A	0.592	0.68
155_A	165_V	0.589	0.68
45_A	58_R	0.588	0.68
112_L	155_A	0.586	0.68
24_A	41_G	0.586	0.68
49_A	143_S	0.584	0.67
51_V	198_R	0.583	0.67
117_L	135_K	0.578	0.67
154_T	202_K	0.577	0.66
84_E	192_L	0.577	0.66
114_P	135_K	0.576	0.66
137_E	152_D	0.576	0.66
38_E	190_S	0.572	0.66
187_I	190_S	0.571	0.66
97_P	166_D	0.570	0.66
117_L	181_L	0.567	0.65
10_G	107_L	0.564	0.65
177_T	192_L	0.555	0.63
125_R	187_I	0.552	0.63
62_T	71_T	0.551	0.63
42_G	115_A	0.550	0.63
74_C	84_E	0.548	0.63
16_A	22_T	0.544	0.62
92_C	98_L	0.542	0.62
27_Q	49_A	0.541	0.62
10_G	14_A	0.539	0.61
11_S	167_A	0.538	0.61
178_T	199_A	0.537	0.61
40_S	133_A	0.537	0.61
26_M	154_T	0.537	0.61
52_D	60_R	0.536	0.61
9_A	13_S	0.534	0.61
29_W	93_L	0.533	0.60
163_A	176_T	0.533	0.60
159_A	187_I	0.532	0.60
111_A	120_V	0.532	0.60
47_V	55_V	0.532	0.60
12_G	129_E	0.532	0.60
25_R	150_A	0.529	0.60
85_D	91_G	0.528	0.60
84_E	94_L	0.528	0.60
31_N	125_R	0.526	0.59
45_A	60_R	0.526	0.59
109_V	113_S	0.525	0.59
24_A	39_V	0.524	0.59
191_T	207_A	0.519	0.58
87_L	130_I	0.519	0.58
27_Q	205_R	0.519	0.58
156_R	191_T	0.518	0.58
38_E	42_G	0.514	0.58
43_G	51_V	0.514	0.58
58_R	75_L	0.513	0.58
169_Y	196_L	0.512	0.57
95_V	177_T	0.509	0.57
36_L	98_L	0.505	0.56
150_A	158_A	0.504	0.56
51_V	54_R	0.503	0.56
23_D	29_W	0.503	0.56
80_A	87_L	0.502	0.56
62_T	66_T	0.501	0.56
109_V	120_V	0.501	0.56
130_I	193_E	0.500	0.56
125_R	175_E	0.500	0.56
161_L	200_E	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4wszA	2	0.2619	97.6	0.833	Contact Map
1s7oA	3	0.3286	97.5	0.838	Contact Map
1ku3A	1	0.2905	97.5	0.838	Contact Map
1je8A	2	0.2667	97.3	0.844	Contact Map
1xsvA	2	0.3238	97.3	0.844	Contact Map
1x3uA	1	0.3143	97.2	0.846	Contact Map
3c57A	2	0.2429	97.2	0.846	Contact Map
2o8xA	7	0.2905	97.1	0.847	Contact Map
1fseA	2	0.2714	97.1	0.849	Contact Map
3hugA	3	0.3619	97.1	0.849	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.