Q9HQD0 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQD0 - Uncharacterized protein

UniProt:	Q9HQD0	Sequences: MQRFAGCTPTAVMAVALGPPPRSVHGFYYRGLLYRRMNDVRLEEALSASRVTVSASAAVPDAATTLREHDATAAVVQRAGDLAGVFTADAVVDAVADGHGLDSVTVADVMADTPVSLSVDATVADAIDAMARTGDGCVLVVDADAEAIGVASAQAIAALAATNDQRRGSRPPLGGPDRTPVGASGGAPGDPPESRDGDPTTAGANTYSEQGVCERCGGLAAALGRVNGRLLCTECRSL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	238 (197)
Sequences:	2706 (1495)
Seq/√Len:	106.5

ECOLI - IMDH
BACSU - IMDH ACUB
HALSA - Q9HQD0 Q9HMW8 IMDH Q9HRK9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
142_D	146_E	4.603	1.00
29_Y	191_P	4.199	1.00
210_Q	214_E	3.683	1.00
166_R	174_G	3.524	1.00
176_P	199_P	3.235	1.00
117_L	140_V	3.209	1.00
53_V	76_V	2.947	1.00
104_V	108_D	2.935	1.00
190_D	194_S	2.860	1.00
35_R	38_N	2.731	1.00
28_Y	31_G	2.691	1.00
60_P	64_T	2.414	1.00
189_G	219_L	2.403	1.00
57_A	61_D	2.377	1.00
179_T	189_G	2.342	1.00
118_S	143_A	2.336	1.00
185_G	215_R	2.322	1.00
214_E	217_G	2.253	1.00
54_S	57_A	2.243	1.00
60_P	103_S	2.217	1.00
189_G	200_T	2.215	1.00
81_D	146_E	2.170	1.00
64_T	68_E	2.117	1.00
190_D	223_L	2.104	1.00
55_A	83_A	2.099	1.00
190_D	222_A	2.094	1.00
122_T	125_D	2.022	1.00
119_V	148_I	1.994	1.00
62_A	86_F	1.896	1.00
218_G	222_A	1.870	1.00
53_V	57_A	1.853	1.00
204_A	212_V	1.818	1.00
125_D	128_D	1.806	1.00
128_D	132_R	1.777	1.00
105_T	108_D	1.772	1.00
25_H	211_G	1.702	1.00
86_F	109_V	1.685	1.00
217_G	221_A	1.640	1.00
117_L	121_A	1.629	1.00
61_D	64_T	1.567	1.00
31_G	34_Y	1.562	1.00
31_G	35_R	1.544	1.00
56_S	107_A	1.540	1.00
141_V	145_A	1.529	1.00
78_R	81_D	1.473	1.00
121_A	125_D	1.464	1.00
58_A	61_D	1.449	1.00
76_V	106_V	1.429	1.00
62_A	66_L	1.426	1.00
123_V	127_I	1.419	1.00
115_V	133_T	1.394	1.00
184_S	187_A	1.391	1.00
53_V	62_A	1.376	1.00
187_A	190_D	1.316	0.99
213_C	217_G	1.299	0.99
145_A	148_I	1.289	0.99
131_A	134_G	1.287	0.99
51_V	71_A	1.279	0.99
215_R	218_G	1.271	0.99
63_A	67_R	1.267	0.99
193_E	197_G	1.260	0.99
214_E	218_G	1.258	0.99
186_G	218_G	1.254	0.99
53_V	106_V	1.253	0.99
157_A	161_A	1.249	0.99
54_S	79_A	1.236	0.99
126_A	138_V	1.236	0.99
66_L	74_A	1.226	0.99
189_G	223_L	1.224	0.99
56_S	105_T	1.213	0.99
55_A	107_A	1.210	0.99
101_L	104_V	1.200	0.99
95_V	100_G	1.167	0.99
202_A	219_L	1.161	0.99
202_A	216_C	1.152	0.98
34_Y	38_N	1.150	0.98
210_Q	213_C	1.129	0.98
222_A	225_R	1.125	0.98
63_A	102_D	1.124	0.98
54_S	78_R	1.109	0.98
46_L	140_V	1.103	0.98
118_S	121_A	1.097	0.98
186_G	222_A	1.094	0.98
95_V	104_V	1.083	0.98
46_L	52_T	1.080	0.98
221_A	224_G	1.079	0.98
63_A	91_V	1.077	0.98
179_T	200_T	1.060	0.97
70_D	88_A	1.051	0.97
51_V	74_A	1.038	0.97
130_M	138_V	1.026	0.97
80_G	146_E	1.020	0.97
34_Y	37_M	1.020	0.97
71_A	74_A	0.992	0.96
59_V	109_V	0.989	0.96
78_R	83_A	0.988	0.96
118_S	144_D	0.988	0.96
66_L	91_V	0.979	0.96
119_V	143_A	0.974	0.96
218_G	221_A	0.964	0.95
174_G	199_P	0.949	0.95
55_A	78_R	0.925	0.94
65_T	74_A	0.915	0.94
104_V	109_V	0.913	0.94
169_S	174_G	0.908	0.94
34_Y	68_E	0.898	0.93
30_R	187_A	0.890	0.93
107_A	112_D	0.889	0.93
118_S	125_D	0.886	0.93
99_H	102_D	0.885	0.93
60_P	102_D	0.878	0.92
168_G	173_L	0.878	0.92
179_T	185_G	0.877	0.92
123_V	156_I	0.864	0.92
187_A	191_P	0.864	0.92
57_A	74_A	0.861	0.92
66_L	71_A	0.852	0.91
127_I	156_I	0.851	0.91
36_R	177_D	0.851	0.91
211_G	214_E	0.846	0.91
179_T	202_A	0.845	0.91
48_A	170_R	0.845	0.91
37_M	148_I	0.844	0.91
54_S	107_A	0.843	0.91
82_L	137_C	0.828	0.90
24_V	27_F	0.827	0.90
59_V	104_V	0.825	0.90
168_G	171_P	0.823	0.90
51_V	76_V	0.822	0.90
55_A	86_F	0.817	0.89
55_A	77_Q	0.816	0.89
183_A	187_A	0.806	0.89
191_P	194_S	0.797	0.88
177_D	197_G	0.796	0.88
56_S	79_A	0.793	0.88
100_G	128_D	0.784	0.87
221_A	225_R	0.781	0.87
56_S	78_R	0.779	0.87
62_A	106_V	0.776	0.87
78_R	146_E	0.775	0.87
180_P	184_S	0.765	0.86
182_G	185_G	0.764	0.86
128_D	131_A	0.764	0.86
210_Q	217_G	0.764	0.86
81_D	144_D	0.762	0.86
181_V	185_G	0.760	0.86
79_A	146_E	0.760	0.86
156_I	160_A	0.760	0.86
95_V	101_L	0.758	0.86
202_A	212_V	0.751	0.85
181_V	215_R	0.748	0.85
114_P	139_L	0.748	0.85
62_A	127_I	0.748	0.85
134_G	220_A	0.747	0.85
99_H	104_V	0.744	0.85
89_D	114_P	0.733	0.84
126_A	150_V	0.731	0.84
32_L	36_R	0.731	0.84
181_V	211_G	0.731	0.84
42_L	162_T	0.730	0.83
183_A	186_G	0.719	0.83
186_G	215_R	0.719	0.83
186_G	189_G	0.716	0.82
54_S	83_A	0.715	0.82
153_A	157_A	0.714	0.82
66_L	138_V	0.694	0.80
127_I	159_L	0.689	0.80
30_R	191_P	0.687	0.80
117_L	139_L	0.677	0.79
91_V	123_V	0.675	0.78
27_F	31_G	0.670	0.78
204_A	211_G	0.667	0.78
50_R	207_Y	0.665	0.77
220_A	224_G	0.663	0.77
54_S	77_Q	0.658	0.77
201_T	205_N	0.657	0.76
58_A	105_T	0.655	0.76
184_S	215_R	0.653	0.76
166_R	170_R	0.646	0.75
75_V	147_A	0.646	0.75
190_D	193_E	0.645	0.75
49_S	147_A	0.643	0.75
46_L	51_V	0.641	0.75
66_L	156_I	0.639	0.75
181_V	184_S	0.637	0.74
211_G	215_R	0.635	0.74
185_G	204_A	0.633	0.74
177_D	192_P	0.631	0.74
33_L	191_P	0.631	0.74
25_H	180_P	0.630	0.73
180_P	188_P	0.629	0.73
197_G	200_T	0.627	0.73
181_V	216_C	0.626	0.73
209_E	213_C	0.624	0.73
82_L	139_L	0.624	0.73
177_D	180_P	0.622	0.73
216_C	220_A	0.621	0.72
63_A	160_A	0.619	0.72
127_I	134_G	0.619	0.72
203_G	207_Y	0.619	0.72
37_M	68_E	0.617	0.72
185_G	202_A	0.616	0.72
75_V	82_L	0.612	0.71
176_P	201_T	0.612	0.71
218_G	223_L	0.608	0.71
118_S	122_T	0.606	0.71
113_T	145_A	0.603	0.70
123_V	159_L	0.602	0.70
43_E	167_R	0.599	0.70
95_V	99_H	0.597	0.69
219_L	224_G	0.596	0.69
41_R	131_A	0.595	0.69
108_D	112_D	0.594	0.69
92_V	140_V	0.592	0.69
53_V	65_T	0.592	0.69
73_A	150_V	0.591	0.69
121_A	140_V	0.587	0.68
29_Y	33_L	0.587	0.68
189_G	193_E	0.584	0.68
119_V	142_D	0.583	0.68
84_G	110_M	0.583	0.68
85_V	111_A	0.581	0.67
68_E	217_G	0.580	0.67
182_G	215_R	0.580	0.67
72_T	216_C	0.578	0.67
73_A	137_C	0.578	0.67
44_E	47_S	0.577	0.67
120_D	140_V	0.577	0.67
56_S	64_T	0.576	0.67
82_L	130_M	0.575	0.67
192_P	198_D	0.570	0.66
41_R	88_A	0.570	0.66
193_E	223_L	0.567	0.66
136_G	154_Q	0.566	0.65
72_T	153_A	0.561	0.65
126_A	130_M	0.560	0.65
117_L	120_D	0.558	0.64
58_A	63_A	0.558	0.64
57_A	106_V	0.558	0.64
181_V	204_A	0.555	0.64
126_A	134_G	0.555	0.64
86_F	153_A	0.553	0.64
60_P	146_E	0.551	0.63
126_A	151_A	0.551	0.63
30_R	190_D	0.549	0.63
77_Q	80_G	0.549	0.63
178_R	207_Y	0.548	0.63
44_E	50_R	0.548	0.63
53_V	91_V	0.546	0.63
73_A	136_G	0.545	0.62
74_A	106_V	0.543	0.62
95_V	102_D	0.542	0.62
89_D	137_C	0.542	0.62
178_R	198_D	0.541	0.62
34_Y	60_P	0.540	0.62
44_E	131_A	0.538	0.61
139_L	147_A	0.537	0.61
109_V	159_L	0.537	0.61
35_R	153_A	0.536	0.61
44_E	196_D	0.535	0.61
92_V	204_A	0.533	0.61
69_H	74_A	0.533	0.61
168_G	172_P	0.531	0.60
144_D	221_A	0.531	0.60
124_A	161_A	0.529	0.60
123_V	129_A	0.529	0.60
25_H	223_L	0.528	0.60
42_L	69_H	0.527	0.60
42_L	140_V	0.527	0.60
186_G	190_D	0.526	0.60
216_C	219_L	0.526	0.60
112_D	145_A	0.526	0.60
65_T	106_V	0.524	0.59
183_A	218_G	0.524	0.59
120_D	125_D	0.523	0.59
61_D	106_V	0.522	0.59
34_Y	63_A	0.522	0.59
78_R	107_A	0.522	0.59
218_G	224_G	0.516	0.58
24_V	28_Y	0.514	0.58
26_G	75_V	0.514	0.58
190_D	218_G	0.513	0.58
180_P	189_G	0.513	0.58
195_R	198_D	0.513	0.58
53_V	123_V	0.513	0.58
118_S	140_V	0.512	0.58
26_G	178_R	0.512	0.58
128_D	144_D	0.511	0.58
64_T	67_R	0.509	0.57
124_A	127_I	0.509	0.57
65_T	69_H	0.508	0.57
157_A	174_G	0.506	0.57
136_G	206_T	0.504	0.57
41_R	53_V	0.501	0.56
47_S	129_A	0.500	0.56
60_P	101_L	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3usbA	4	0.9622	99.9	0.565	Contact Map
1jcnA	6	0.7983	99.9	0.566	Contact Map
1vrdA	3	0.5042	99.9	0.574	Contact Map
4af0A	3	0.4916	99.9	0.576	Contact Map
3l2bA	2	0.4958	99.9	0.578	Contact Map
1zfjA	4	0.9664	99.9	0.596	Contact Map
2cu0A	4	0.4832	99.9	0.596	Contact Map
4cooA	2	0.6807	99.9	0.596	Contact Map
5ahnA	3	0.4958	99.9	0.601	Contact Map
3fhmA	2	0.5504	99.9	0.604	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0083 seconds.