Q9HQC4 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQC4 - Uncharacterized protein

UniProt:	Q9HQC4	Sequences: MDAAQETRRNPYGMDEDCRNCAGLCDQRERVVHGYGDVGADFVFVAESPSAASEAAGVPLVGDDAGERFQHILGSVGLNHSLPSSTEPELANAYVTLLSRCRHPDREATADERTRCEPYLNADIRMINPEVLVPVGQRALTELGKEYTTTPADSLAVTELHGDTVRGRGFELVPMIHPREQSDAQTDAWIDFFLSFKDTDYRQTKGRRSR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	210 (173)
Sequences:	3079 (2184)
Seq/√Len:	166.1

HALSA - Q9HQC4 Q9HNJ0 Q9HRG7
SULSO - Q97VA2 Q97WF1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_Y	58_V	4.504	1.00
41_D	130_E	3.899	1.00
43_V	124_I	3.029	1.00
44_F	133_V	2.745	1.00
79_N	91_A	2.505	1.00
117_E	121_N	2.488	1.00
48_S	99_S	2.330	1.00
164_T	173_V	2.304	1.00
122_A	125_R	2.250	1.00
107_E	138_R	2.154	1.00
15_D	31_V	2.117	1.00
43_V	127_I	2.116	1.00
51_A	55_A	2.079	1.00
21_C	116_C	2.000	1.00
75_S	194_L	1.988	1.00
72_I	193_F	1.978	1.00
28_R	101_C	1.949	1.00
103_H	112_E	1.867	1.00
137_Q	141_T	1.831	1.00
35_Y	80_H	1.790	1.00
19_R	25_C	1.788	1.00
7_T	10_N	1.749	1.00
166_R	171_E	1.720	1.00
25_C	28_R	1.711	1.00
72_I	189_W	1.705	1.00
15_D	33_H	1.683	1.00
164_T	171_E	1.619	1.00
44_F	69_F	1.611	1.00
8_R	38_V	1.609	1.00
186_T	190_I	1.605	1.00
70_Q	80_H	1.603	1.00
134_P	174_P	1.603	1.00
180_E	184_A	1.593	1.00
128_N	170_F	1.561	1.00
18_C	21_C	1.561	1.00
18_C	116_C	1.558	1.00
43_V	96_T	1.527	1.00
11_P	126_M	1.508	1.00
22_A	111_D	1.505	1.00
18_C	101_C	1.498	1.00
158_T	176_I	1.490	1.00
107_E	141_T	1.481	1.00
12_Y	16_E	1.468	1.00
94_Y	123_D	1.454	1.00
52_A	56_A	1.446	1.00
134_P	172_L	1.445	1.00
73_L	93_A	1.419	1.00
166_R	169_G	1.401	1.00
52_A	55_A	1.388	1.00
107_E	137_Q	1.379	1.00
124_I	132_L	1.364	1.00
132_L	170_F	1.360	1.00
131_V	173_V	1.351	1.00
22_A	26_D	1.340	1.00
41_D	92_N	1.335	1.00
14_M	122_A	1.334	1.00
190_I	194_L	1.332	1.00
113_R	142_E	1.326	1.00
106_R	112_E	1.324	1.00
101_C	116_C	1.302	1.00
29_E	55_A	1.288	1.00
156_A	159_E	1.283	1.00
75_S	190_I	1.278	1.00
140_L	174_P	1.263	1.00
100_R	123_D	1.236	1.00
79_N	92_N	1.233	1.00
44_F	73_L	1.224	1.00
28_R	31_V	1.195	1.00
48_S	103_H	1.146	1.00
98_L	142_E	1.145	1.00
193_F	196_F	1.144	1.00
20_N	118_P	1.136	1.00
52_A	63_D	1.123	1.00
133_V	196_F	1.119	1.00
134_P	140_L	1.117	1.00
76_V	197_K	1.099	1.00
96_T	123_D	1.097	1.00
44_F	135_V	1.065	0.99
135_V	175_M	1.065	0.99
53_S	61_V	1.062	0.99
140_L	155_L	1.048	0.99
110_A	114_T	1.041	0.99
32_V	59_P	1.040	0.99
146_E	155_L	1.034	0.99
16_E	31_V	1.032	0.99
37_D	92_N	1.011	0.99
160_L	163_D	1.010	0.99
42_F	133_V	0.999	0.99
134_P	143_L	0.996	0.99
113_R	138_R	0.994	0.99
72_I	76_V	0.988	0.99
10_N	13_G	0.981	0.99
50_S	53_S	0.973	0.99
71_H	75_S	0.964	0.99
144_G	172_L	0.960	0.99
37_D	40_A	0.960	0.99
195_S	198_D	0.958	0.99
131_V	171_E	0.958	0.99
46_A	60_L	0.952	0.99
12_Y	33_H	0.947	0.99
96_T	120_L	0.944	0.99
8_R	126_M	0.942	0.99
13_G	17_D	0.940	0.99
134_P	139_A	0.938	0.99
173_V	196_F	0.933	0.99
13_G	16_E	0.929	0.99
133_V	175_M	0.927	0.99
181_Q	189_W	0.924	0.99
21_C	101_C	0.913	0.98
121_N	125_R	0.911	0.98
140_L	160_L	0.911	0.98
45_V	134_P	0.902	0.98
51_A	102_R	0.900	0.98
19_R	26_D	0.891	0.98
10_N	14_M	0.878	0.98
42_F	78_L	0.865	0.98
20_N	119_Y	0.859	0.98
117_E	142_E	0.858	0.98
155_L	160_L	0.855	0.98
34_G	94_Y	0.847	0.97
22_A	25_C	0.847	0.97
22_A	109_T	0.846	0.97
194_L	198_D	0.844	0.97
45_V	143_L	0.842	0.97
118_P	122_A	0.838	0.97
18_C	100_R	0.826	0.97
180_E	183_D	0.818	0.97
67_E	70_Q	0.811	0.97
21_C	24_L	0.804	0.96
25_C	31_V	0.803	0.96
122_A	126_M	0.800	0.96
9_R	13_G	0.799	0.96
43_V	132_L	0.798	0.96
67_E	71_H	0.797	0.96
186_T	189_W	0.794	0.96
45_V	120_L	0.793	0.96
24_L	28_R	0.784	0.96
138_R	141_T	0.781	0.96
42_F	196_F	0.776	0.96
137_Q	156_A	0.774	0.96
118_P	121_N	0.773	0.96
157_V	174_P	0.773	0.96
187_D	190_I	0.771	0.95
187_D	191_D	0.767	0.95
188_A	191_D	0.764	0.95
61_V	97_L	0.763	0.95
114_T	145_K	0.761	0.95
124_I	143_L	0.741	0.94
44_F	93_A	0.741	0.94
7_T	126_M	0.740	0.94
102_R	105_D	0.732	0.94
50_S	65_A	0.730	0.94
46_A	177_H	0.730	0.94
191_D	195_S	0.726	0.94
68_R	190_I	0.721	0.94
111_D	114_T	0.721	0.94
110_A	141_T	0.717	0.93
37_D	94_Y	0.716	0.93
25_C	101_C	0.716	0.93
50_S	97_L	0.713	0.93
42_F	93_A	0.701	0.93
56_A	61_V	0.700	0.93
189_W	193_F	0.694	0.92
146_E	160_L	0.693	0.92
60_L	104_P	0.692	0.92
96_T	100_R	0.690	0.92
78_L	93_A	0.683	0.92
186_T	192_F	0.683	0.92
98_L	113_R	0.681	0.91
193_F	197_K	0.679	0.91
12_Y	38_V	0.675	0.91
50_S	59_P	0.675	0.91
70_Q	95_V	0.674	0.91
186_T	193_F	0.669	0.91
124_I	170_F	0.669	0.91
74_G	79_N	0.666	0.91
132_L	143_L	0.665	0.90
98_L	117_E	0.659	0.90
20_N	115_R	0.653	0.90
179_R	183_D	0.652	0.90
167_G	172_L	0.651	0.90
12_Y	31_V	0.650	0.89
176_I	188_A	0.650	0.89
9_R	12_Y	0.650	0.89
9_R	38_V	0.648	0.89
15_D	119_Y	0.646	0.89
18_C	28_R	0.645	0.89
24_L	54_E	0.644	0.89
102_R	106_R	0.643	0.89
68_R	181_Q	0.640	0.89
181_Q	186_T	0.639	0.89
97_L	177_H	0.639	0.89
129_P	132_L	0.637	0.89
145_K	154_S	0.636	0.88
161_H	175_M	0.631	0.88
30_R	54_E	0.630	0.88
181_Q	184_A	0.627	0.88
144_G	165_V	0.626	0.88
176_I	180_E	0.626	0.88
34_G	123_D	0.624	0.88
8_R	12_Y	0.622	0.87
33_H	94_Y	0.621	0.87
59_P	97_L	0.621	0.87
72_I	181_Q	0.617	0.87
71_H	194_L	0.616	0.87
27_Q	30_R	0.616	0.87
8_R	11_P	0.614	0.87
42_F	131_V	0.612	0.87
191_D	194_L	0.603	0.86
155_L	174_P	0.600	0.85
164_T	195_S	0.598	0.85
71_H	74_G	0.598	0.85
40_A	96_T	0.597	0.85
73_L	76_V	0.596	0.85
63_D	185_Q	0.594	0.85
29_E	54_E	0.593	0.85
31_V	101_C	0.588	0.84
165_V	174_P	0.583	0.84
51_A	63_D	0.581	0.84
134_P	165_V	0.581	0.84
167_G	171_E	0.580	0.83
72_I	190_I	0.575	0.83
160_L	174_P	0.570	0.82
111_D	115_R	0.565	0.82
175_M	189_W	0.563	0.82
188_A	192_F	0.562	0.82
125_R	168_R	0.557	0.81
189_W	192_F	0.556	0.81
68_R	183_D	0.555	0.81
48_S	63_D	0.553	0.80
59_P	65_A	0.550	0.80
28_R	54_E	0.547	0.80
97_L	105_D	0.546	0.80
68_R	182_S	0.544	0.79
14_M	119_Y	0.542	0.79
12_Y	94_Y	0.542	0.79
59_P	68_R	0.542	0.79
11_P	15_D	0.540	0.79
24_L	116_C	0.538	0.79
131_V	196_F	0.537	0.79
160_L	165_V	0.534	0.78
47_E	97_L	0.533	0.78
53_S	70_Q	0.530	0.78
70_Q	73_L	0.530	0.78
167_G	170_F	0.529	0.78
76_V	194_L	0.525	0.77
98_L	141_T	0.524	0.77
120_L	124_I	0.519	0.76
30_R	57_G	0.518	0.76
69_F	73_L	0.517	0.76
94_Y	127_I	0.517	0.76
40_A	127_I	0.516	0.76
46_A	97_L	0.516	0.76
32_V	53_S	0.513	0.75
99_S	135_V	0.510	0.75
47_E	61_V	0.508	0.75
71_H	190_I	0.506	0.74
76_V	193_F	0.503	0.74
36_G	40_A	0.502	0.74
180_E	193_F	0.500	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vk2A	1	0.8714	100	0.255	Contact Map
1ui0A	1	0.8714	100	0.269	Contact Map
2d3yA	1	0.9381	100	0.302	Contact Map
3ikbA	1	0.8524	100	0.357	Contact Map
1wywA	1	0.8476	100	0.48	Contact Map
1mugA	1	0.7476	100	0.542	Contact Map
1oe4A	2	0.8429	100	0.558	Contact Map
2c2qA	1	0.8286	99.9	0.607	Contact Map
2l3fA	1	0.7333	98.6	0.836	Contact Map
1vddA	7	0.619	35.5	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.