Q9HQB6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQB6 - Uncharacterized protein

UniProt:	Q9HQB6	Sequences: MTLDGLDDLDRTILHALQRDARSTSSQDIADEADVSASTVRNRIGRLEERGILTGYHADVDYEQAGYQLYTLIVCTAPVPQREELAAAAVDVPGVVRVEEVMTGTENIHVFAVGADSDDLSRIGRDLDELGLEVADEDLIRSVHAGPFDGFSTPSANDTE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	160 (137)
Sequences:	13564 (8694)
Seq/√Len:	742.8

ECOLI - ASNC LRP YBAO
BACSU - YUGG YWRC LRPB AZLB LRPC YEZC LRPA
HALSA - Q9HQB6 Q9HQ33 Q9HNI1 Q9HQ13 Q9HP41 Q9HQG1 Q9HP70 Q9HNW8 Q9HQ80
SULSO - Q7LX67 Q7LXS6 Q97XP7 Q97W90 LYSM Q980P3 Q97X78 Q97VN7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_A	32_E	2.899	1.00
48_E	56_Y	2.800	1.00
76_T	134_V	2.505	1.00
105_T	136_D	2.461	1.00
97_R	111_F	2.315	1.00
115_A	119_D	2.262	1.00
26_S	44_I	2.184	1.00
46_R	50_R	2.051	1.00
92_V	126_D	2.029	1.00
63_E	118_D	2.019	1.00
16_A	23_S	2.005	1.00
54_T	61_D	1.962	1.00
10_D	43_R	1.920	1.00
70_Y	111_F	1.873	1.00
78_P	133_E	1.850	1.00
72_L	99_E	1.796	1.00
96_V	113_V	1.771	1.00
54_T	59_D	1.769	1.00
9_L	35_V	1.720	1.00
16_A	19_R	1.656	1.00
74_V	138_D	1.636	1.00
92_V	123_I	1.634	1.00
45_G	49_E	1.624	1.00
35_V	39_T	1.621	1.00
27_Q	31_D	1.590	1.00
23_S	32_E	1.532	1.00
116_D	119_D	1.517	1.00
28_D	31_D	1.511	1.00
27_Q	37_A	1.498	1.00
119_D	122_R	1.489	1.00
88_A	130_L	1.473	1.00
88_A	91_D	1.457	1.00
36_S	39_T	1.442	1.00
35_V	40_V	1.438	1.00
13_I	29_I	1.405	1.00
26_S	41_R	1.400	1.00
85_L	89_A	1.397	1.00
86_A	90_V	1.392	1.00
81_Q	84_E	1.389	1.00
94_G	119_D	1.372	1.00
74_V	106_E	1.353	1.00
76_T	105_T	1.347	1.00
75_C	110_V	1.343	1.00
22_R	56_Y	1.334	1.00
8_D	12_T	1.318	1.00
33_A	40_V	1.313	1.00
83_E	87_A	1.311	1.00
73_I	112_A	1.281	1.00
23_S	29_I	1.270	1.00
69_L	117_S	1.267	1.00
76_T	133_E	1.252	1.00
122_R	125_R	1.251	1.00
67_Y	115_A	1.246	1.00
28_D	32_E	1.237	1.00
17_L	44_I	1.227	1.00
9_L	12_T	1.227	1.00
77_A	85_L	1.203	1.00
94_G	126_D	1.196	1.00
86_A	142_S	1.181	1.00
20_D	32_E	1.167	1.00
45_G	48_E	1.153	1.00
19_R	32_E	1.146	1.00
121_S	142_S	1.142	1.00
16_A	29_I	1.115	1.00
70_Y	113_V	1.104	1.00
55_G	59_D	1.089	1.00
7_D	43_R	1.074	1.00
9_L	33_A	1.063	1.00
12_T	15_H	1.043	1.00
95_V	112_A	1.041	1.00
12_T	16_A	1.016	1.00
114_G	119_D	1.015	1.00
98_V	110_V	1.012	1.00
74_V	136_D	1.004	1.00
86_A	108_I	0.998	1.00
84_E	88_A	0.990	1.00
23_S	28_D	0.986	1.00
26_S	30_A	0.981	1.00
72_L	109_H	0.974	1.00
22_R	48_E	0.974	1.00
41_R	45_G	0.966	1.00
12_T	33_A	0.963	1.00
30_A	40_V	0.960	1.00
61_D	64_Q	0.954	1.00
15_H	19_R	0.951	1.00
21_A	56_Y	0.947	1.00
87_A	90_V	0.945	1.00
72_L	111_F	0.934	1.00
99_E	111_F	0.934	1.00
37_A	41_R	0.919	1.00
114_G	120_L	0.917	1.00
112_A	123_I	0.906	1.00
114_G	123_I	0.896	1.00
30_A	35_V	0.878	1.00
105_T	134_V	0.876	1.00
26_S	37_A	0.874	1.00
68_Q	116_D	0.873	1.00
27_Q	41_R	0.872	1.00
78_P	81_Q	0.865	1.00
6_L	11_R	0.864	1.00
87_A	91_D	0.859	1.00
62_Y	113_V	0.856	1.00
21_A	28_D	0.852	1.00
47_L	52_I	0.847	1.00
95_V	98_V	0.837	1.00
10_D	46_R	0.826	1.00
74_V	109_H	0.824	1.00
88_A	92_V	0.823	1.00
38_S	42_N	0.820	1.00
83_E	86_A	0.819	1.00
11_R	15_H	0.817	1.00
95_V	110_V	0.797	1.00
99_E	140_I	0.793	1.00
6_L	52_I	0.790	1.00
20_D	23_S	0.780	1.00
75_C	85_L	0.777	1.00
122_R	126_D	0.769	1.00
7_D	10_D	0.769	1.00
29_I	44_I	0.767	1.00
29_I	40_V	0.765	1.00
13_I	40_V	0.752	1.00
124_G	137_E	0.751	1.00
84_E	87_A	0.749	1.00
99_E	143_V	0.741	1.00
16_A	20_D	0.737	1.00
72_L	140_I	0.735	1.00
103_T	139_L	0.734	1.00
21_A	58_A	0.733	1.00
89_A	98_V	0.727	1.00
126_D	130_L	0.721	1.00
8_D	11_R	0.719	1.00
94_G	123_I	0.713	1.00
86_A	144_H	0.710	1.00
13_I	43_R	0.708	1.00
106_E	136_D	0.705	1.00
76_T	106_E	0.705	1.00
118_D	121_S	0.698	1.00
67_Y	94_G	0.697	1.00
84_E	131_G	0.691	1.00
82_R	108_I	0.689	1.00
67_Y	113_V	0.680	1.00
42_N	46_R	0.678	1.00
70_Y	143_V	0.676	1.00
30_A	37_A	0.676	1.00
118_D	122_R	0.673	1.00
74_V	105_T	0.673	1.00
38_S	41_R	0.669	1.00
14_L	47_L	0.660	1.00
89_A	110_V	0.659	1.00
71_T	120_L	0.658	1.00
117_S	139_L	0.655	1.00
43_R	47_L	0.651	1.00
13_I	16_A	0.649	1.00
73_I	110_V	0.645	1.00
70_Y	140_I	0.643	1.00
85_L	108_I	0.643	1.00
42_N	45_G	0.641	1.00
124_G	135_A	0.641	1.00
71_T	139_L	0.640	1.00
52_I	64_Q	0.640	1.00
21_A	55_G	0.640	1.00
94_G	115_A	0.637	1.00
78_P	131_G	0.629	1.00
10_D	47_L	0.628	1.00
13_I	23_S	0.624	1.00
92_V	130_L	0.619	1.00
51_G	54_T	0.619	1.00
128_D	135_A	0.619	1.00
101_V	109_H	0.618	1.00
13_I	44_I	0.615	1.00
119_D	123_I	0.609	1.00
27_Q	30_A	0.603	1.00
75_C	132_L	0.600	1.00
83_E	129_E	0.590	1.00
73_I	135_A	0.590	1.00
61_D	65_A	0.589	1.00
100_E	108_I	0.583	1.00
83_E	125_R	0.582	1.00
13_I	47_L	0.581	1.00
60_V	65_A	0.579	1.00
71_T	137_E	0.576	1.00
76_T	136_D	0.571	1.00
59_D	62_Y	0.569	1.00
26_S	40_V	0.565	1.00
77_A	107_N	0.559	1.00
18_Q	57_H	0.558	1.00
70_Y	99_E	0.548	1.00
53_L	56_Y	0.545	1.00
124_G	141_R	0.543	1.00
82_R	128_D	0.540	1.00
9_L	39_T	0.538	1.00
46_R	49_E	0.536	1.00
71_T	114_G	0.533	1.00
33_A	39_T	0.529	1.00
20_D	28_D	0.527	1.00
96_V	111_F	0.525	1.00
15_H	18_Q	0.521	1.00
117_S	141_R	0.520	1.00
101_V	106_E	0.517	1.00
123_I	127_L	0.516	1.00
79_V	133_E	0.515	1.00
121_S	125_R	0.515	1.00
10_D	50_R	0.513	1.00
89_A	127_L	0.512	1.00
100_E	103_T	0.502	1.00
16_A	33_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ch7A	1	0.9437	100	0.172	Contact Map
4un1B	1	0.9375	100	0.222	Contact Map
4un1A	1	0.8812	100	0.248	Contact Map
4pcqA	2	0.9125	100	0.257	Contact Map
2e1cA	1	0.9125	100	0.261	Contact Map
2p5vA	5	0.9625	100	0.262	Contact Map
2ia0A	2	0.9187	100	0.27	Contact Map
2cg4A	6	0.9125	99.9	0.281	Contact Map
3i4pA	5	0.9313	99.9	0.288	Contact Map
2pn6A	5	0.9125	99.9	0.303	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.