Q9HQ99 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQ99 - Uncharacterized protein

UniProt:	Q9HQ99	Sequences: MAADLAEKTDRYEGLLADALAAADPVPPAGSPLGEAAAEYFEMAESYLEDGRHFRAHDDPVNALAAFSYGHAWLDAGARIGLFDVPAAGELFTV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	94 (87)
Sequences:	127 (81)
Seq/√Len:	8.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_L	71_H	3.173	0.92
34_G	38_A	2.798	0.86
16_L	70_G	2.630	0.82
64_L	68_S	2.473	0.78
78_A	85_V	2.255	0.71
43_M	50_D	2.202	0.69
16_L	51_G	2.046	0.63
73_W	93_T	2.039	0.63
51_G	67_F	1.980	0.60
51_G	70_G	1.959	0.59
50_D	54_F	1.829	0.54
43_M	54_F	1.817	0.53
20_L	59_D	1.706	0.49
71_H	78_A	1.673	0.47
10_D	55_R	1.596	0.44
47_Y	50_D	1.572	0.43
64_L	74_L	1.554	0.42
36_A	48_L	1.539	0.42
43_M	47_Y	1.529	0.41
13_E	51_G	1.520	0.41
54_F	62_N	1.389	0.36
8_K	83_F	1.366	0.35
64_L	70_G	1.291	0.32
78_A	93_T	1.262	0.31
67_F	70_G	1.259	0.31
43_M	59_D	1.258	0.31
16_L	67_F	1.228	0.29
24_D	84_D	1.220	0.29
7_E	56_A	1.205	0.29
72_A	76_A	1.177	0.28
48_L	52_R	1.111	0.26
28_P	31_S	1.092	0.25
44_A	67_F	1.090	0.25
11_R	68_S	1.070	0.24
45_E	49_E	1.060	0.24
23_A	64_L	1.048	0.24
11_R	27_P	1.048	0.24
42_E	74_L	1.035	0.23
7_E	11_R	1.029	0.23
40_Y	72_A	1.003	0.22
51_G	64_L	0.999	0.22
23_A	53_H	0.997	0.22
15_L	89_G	0.996	0.22
9_T	70_G	0.974	0.21
27_P	72_A	0.971	0.21
50_D	59_D	0.971	0.21
17_A	38_A	0.968	0.21
21_A	24_D	0.962	0.21
55_R	66_A	0.959	0.21
12_Y	19_A	0.953	0.21
39_E	76_A	0.942	0.20
47_Y	59_D	0.924	0.20
88_A	93_T	0.905	0.19
37_A	83_F	0.899	0.19
13_E	16_L	0.881	0.19
21_A	34_G	0.880	0.19
22_A	88_A	0.871	0.19
27_P	80_I	0.864	0.18
47_Y	54_F	0.844	0.18
40_Y	48_L	0.840	0.18
15_L	64_L	0.837	0.18
22_A	91_L	0.835	0.18
63_A	84_D	0.834	0.18
32_P	39_E	0.834	0.18
79_R	82_L	0.833	0.18
44_A	61_V	0.832	0.18
65_A	72_A	0.828	0.17
28_P	54_F	0.827	0.17
61_V	71_H	0.819	0.17
41_F	72_A	0.819	0.17
73_W	82_L	0.817	0.17
12_Y	79_R	0.815	0.17
53_H	71_H	0.809	0.17
18_D	58_D	0.806	0.17
13_E	70_G	0.799	0.17
23_A	58_D	0.794	0.17
8_K	37_A	0.786	0.16
23_A	61_V	0.786	0.16
29_A	58_D	0.785	0.16
19_A	75_D	0.770	0.16
28_P	73_W	0.765	0.16
44_A	76_A	0.762	0.16
6_A	83_F	0.756	0.16
17_A	49_E	0.749	0.16
19_A	79_R	0.748	0.16
13_E	67_F	0.748	0.16
75_D	79_R	0.742	0.15
9_T	16_L	0.739	0.15
30_G	35_E	0.736	0.15
23_A	74_L	0.735	0.15
51_G	63_A	0.727	0.15
51_G	68_S	0.717	0.15
42_E	46_S	0.708	0.15
25_P	41_F	0.707	0.15
35_E	56_A	0.700	0.15
18_D	76_A	0.689	0.14
9_T	48_L	0.680	0.14
80_I	87_A	0.680	0.14
78_A	89_G	0.677	0.14
14_G	34_G	0.672	0.14
55_R	85_V	0.669	0.14
23_A	68_S	0.668	0.14
14_G	18_D	0.661	0.14
49_E	78_A	0.658	0.14
70_G	90_E	0.654	0.14
52_R	76_A	0.652	0.14
7_E	63_A	0.651	0.14
29_A	45_E	0.647	0.13
19_A	83_F	0.642	0.13
30_G	39_E	0.627	0.13
41_F	80_I	0.618	0.13
54_F	73_W	0.595	0.12
38_A	52_R	0.594	0.12
21_A	28_P	0.592	0.12
20_L	65_A	0.587	0.12
60_P	70_G	0.587	0.12
50_D	53_H	0.583	0.12
15_L	23_A	0.577	0.12
11_R	70_G	0.567	0.12
87_A	93_T	0.550	0.12
35_E	82_L	0.546	0.12
46_S	62_N	0.539	0.11
82_L	89_G	0.533	0.11
64_L	67_F	0.525	0.11
50_D	66_A	0.511	0.11
6_A	33_L	0.510	0.11
47_Y	53_H	0.510	0.11
8_K	70_G	0.506	0.11
17_A	21_A	0.503	0.11
44_A	74_L	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2oo2A	2	0.7979	99.9	0.37	Contact Map
4fzpA	2	0.8511	99.9	0.409	Contact Map
3u84A	2	0.9255	26	0.924	Contact Map
2x5oA	1	0.6702	22.3	0.926	Contact Map
1sf9A	1	0.6702	21.4	0.927	Contact Map
3lk7A	1	0.6809	13.9	0.933	Contact Map
3j8bE	1	0.7234	13.9	0.933	Contact Map
2yxyA	1	0.6915	13.7	0.933	Contact Map
4gq4A	1	0.766	12.9	0.934	Contact Map
4qinA	2	0.8191	12.6	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0241 seconds.