Q9HQ84 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQ84 - Uncharacterized protein

UniProt:	Q9HQ84	Sequences: MADGGDVNHVIVKAARTHGVRLEFDFAGVLRASGGDRVQALRGLRKLRELVEHYDAPFVVSGRPASHLHVRSPRELVAVGAEIGFTDAQVRAGLREWTHLAARNRRRLSAEFIAPGVKRGRYEEDP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	126 (116)
Sequences:	130 (89)
Seq/√Len:	8.3

HALSA - Q9HQ84

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_V	22_L	5.832	1.00
52_E	89_Q	4.140	0.98
21_R	96_E	3.297	0.93
21_R	100_L	2.837	0.85
19_G	100_L	2.578	0.79
107_R	118_K	2.248	0.69
48_R	85_F	2.174	0.66
22_L	83_I	2.128	0.64
79_V	91_R	1.983	0.58
4_G	75_E	1.967	0.58
15_A	66_S	1.941	0.57
17_T	63_R	1.888	0.55
86_T	100_L	1.884	0.54
86_T	89_Q	1.879	0.54
24_F	51_V	1.827	0.52
79_V	85_F	1.788	0.50
96_E	100_L	1.746	0.49
35_G	38_V	1.683	0.46
18_H	72_S	1.661	0.45
73_P	80_G	1.653	0.45
61_S	73_P	1.610	0.43
39_Q	92_A	1.600	0.43
50_L	119_R	1.581	0.42
69_H	77_V	1.478	0.38
17_T	86_T	1.420	0.35
110_A	113_I	1.419	0.35
79_V	95_R	1.403	0.35
47_L	51_V	1.380	0.34
18_H	26_F	1.372	0.34
57_P	94_L	1.322	0.32
24_F	94_L	1.310	0.31
41_L	49_E	1.309	0.31
25_D	50_L	1.257	0.29
86_T	90_V	1.248	0.29
23_E	61_S	1.230	0.29
39_Q	89_Q	1.197	0.27
16_R	42_R	1.188	0.27
96_E	99_H	1.159	0.26
17_T	65_A	1.133	0.25
6_D	53_H	1.102	0.24
20_V	94_L	1.085	0.24
53_H	90_V	1.084	0.24
24_F	38_V	1.083	0.24
58_F	93_G	1.064	0.23
30_L	83_I	1.055	0.23
30_L	82_E	1.048	0.23
19_G	45_R	1.037	0.22
53_H	100_L	1.033	0.22
9_H	23_E	1.027	0.22
23_E	112_F	1.025	0.22
56_A	79_V	1.023	0.22
60_V	93_G	1.020	0.22
8_N	45_R	1.000	0.21
54_Y	58_F	0.990	0.21
42_R	54_Y	0.980	0.21
25_D	63_R	0.972	0.21
21_R	64_P	0.959	0.20
22_L	47_L	0.946	0.20
99_H	118_K	0.944	0.20
13_K	54_Y	0.940	0.20
61_S	90_V	0.939	0.20
63_R	110_A	0.938	0.20
31_R	45_R	0.926	0.19
16_R	41_L	0.924	0.19
111_E	114_A	0.923	0.19
14_A	104_N	0.921	0.19
16_R	50_L	0.918	0.19
41_L	94_L	0.916	0.19
77_V	85_F	0.903	0.19
71_R	79_V	0.894	0.19
52_E	95_R	0.884	0.18
66_S	86_T	0.883	0.18
85_F	95_R	0.880	0.18
36_D	86_T	0.878	0.18
75_E	82_E	0.873	0.18
42_R	91_R	0.871	0.18
83_I	89_Q	0.863	0.18
56_A	94_L	0.862	0.18
34_G	59_V	0.855	0.18
15_A	37_R	0.843	0.17
32_A	65_A	0.824	0.17
40_A	94_L	0.822	0.17
46_K	56_A	0.820	0.17
24_F	35_G	0.819	0.17
8_N	54_Y	0.819	0.17
61_S	103_R	0.800	0.16
7_V	16_R	0.796	0.16
39_Q	90_V	0.796	0.16
28_G	86_T	0.794	0.16
30_L	76_L	0.788	0.16
19_G	61_S	0.787	0.16
11_I	42_R	0.785	0.16
29_V	55_D	0.782	0.16
25_D	58_F	0.779	0.16
48_R	51_V	0.773	0.16
34_G	78_A	0.772	0.16
50_L	63_R	0.758	0.15
29_V	117_V	0.751	0.15
75_E	119_R	0.750	0.15
69_H	89_Q	0.748	0.15
12_V	69_H	0.739	0.15
16_R	19_G	0.737	0.15
36_D	69_H	0.737	0.15
26_F	94_L	0.735	0.15
8_N	113_I	0.734	0.15
67_H	104_N	0.728	0.15
41_L	82_E	0.726	0.15
25_D	113_I	0.723	0.15
75_E	112_F	0.719	0.15
52_E	83_I	0.715	0.14
7_V	43_G	0.707	0.14
33_S	41_L	0.706	0.14
13_K	19_G	0.704	0.14
29_V	56_A	0.703	0.14
17_T	34_G	0.701	0.14
106_R	118_K	0.699	0.14
11_I	118_K	0.695	0.14
5_G	49_E	0.695	0.14
64_P	96_E	0.685	0.14
112_F	120_G	0.685	0.14
26_F	30_L	0.684	0.14
26_F	107_R	0.683	0.14
110_A	119_R	0.682	0.14
54_Y	69_H	0.670	0.14
9_H	68_L	0.667	0.14
13_K	69_H	0.663	0.13
100_L	107_R	0.662	0.13
8_N	64_P	0.655	0.13
16_R	118_K	0.654	0.13
44_L	81_A	0.650	0.13
15_A	47_L	0.650	0.13
59_V	76_L	0.645	0.13
47_L	59_V	0.643	0.13
57_P	72_S	0.641	0.13
29_V	53_H	0.636	0.13
55_D	100_L	0.634	0.13
41_L	73_P	0.634	0.13
59_V	93_G	0.630	0.13
8_N	18_H	0.626	0.13
65_A	87_D	0.625	0.13
35_G	58_F	0.625	0.13
22_L	118_K	0.623	0.13
10_V	94_L	0.612	0.12
15_A	22_L	0.608	0.12
58_F	111_E	0.605	0.12
24_F	73_P	0.600	0.12
28_G	111_E	0.597	0.12
33_S	63_R	0.595	0.12
10_V	40_A	0.591	0.12
13_K	36_D	0.569	0.12
31_R	62_G	0.567	0.12
53_H	83_I	0.566	0.12
4_G	73_P	0.565	0.12
21_R	99_H	0.563	0.12
4_G	119_R	0.559	0.12
76_L	80_G	0.555	0.11
45_R	57_P	0.553	0.11
15_A	78_A	0.547	0.11
33_S	82_E	0.545	0.11
22_L	53_H	0.544	0.11
22_L	94_L	0.542	0.11
55_D	102_A	0.542	0.11
4_G	53_H	0.535	0.11
24_F	58_F	0.529	0.11
92_A	113_I	0.529	0.11
56_A	67_H	0.528	0.11
3_D	90_V	0.521	0.11
92_A	118_K	0.518	0.11
12_V	70_V	0.514	0.11
3_D	22_L	0.511	0.11
21_R	53_H	0.508	0.11
8_N	29_V	0.508	0.11
32_A	79_V	0.507	0.11
94_L	115_P	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1v77A	1	0.8095	99.4	0.715	Contact Map
1m65A	3	0.7778	97.3	0.845	Contact Map
3b0xA	1	0.7778	97	0.853	Contact Map
2w9mA	1	0.7778	96.3	0.865	Contact Map
2wjeA	1	0.8016	87.6	0.9	Contact Map
2yxoA	3	0.7778	82.9	0.907	Contact Map
4gc3A	1	0.7302	81.8	0.908	Contact Map
2anuA	5	0.6429	79	0.91	Contact Map
3qy7A	1	0.8254	78.6	0.91	Contact Map
3dcpA	1	0.619	74.5	0.914	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.