Q9HQ79 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQ79 - Uncharacterized protein

UniProt:	Q9HQ79	Sequences: MSEVPFHYIDLRVFCYDTEADSRVADALGHFLPEDVEIERTDSEGHLGDRIGVLSTRVERADDMRHVLDQLRDGADIEQIRDQLDERVDDNCSLFVHLDKQAAYLGDAQLGDGISLRAKVEAYPAKKDAAVENARDALAD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	140 (131)
Sequences:	163 (130)
Seq/√Len:	11.3

HALSA - Q9HQ79
SULSO - Q7LXL1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_Y	49_D	3.952	0.99
89_D	93_S	3.562	0.98
71_L	98_L	3.261	0.97
24_V	103_A	3.018	0.95
99_D	102_A	2.370	0.84
32_L	96_V	2.269	0.82
18_T	101_Q	2.240	0.81
9_I	33_P	2.238	0.81
39_E	44_E	2.226	0.80
6_F	118_A	2.205	0.80
77_I	92_C	2.101	0.76
103_A	124_P	2.041	0.74
16_Y	125_A	1.962	0.71
13_V	126_K	1.805	0.64
80_I	94_L	1.778	0.63
83_Q	87_R	1.756	0.62
22_S	80_I	1.684	0.59
89_D	92_C	1.681	0.58
6_F	137_A	1.650	0.57
94_L	110_L	1.559	0.52
28_L	32_L	1.555	0.52
12_R	130_A	1.545	0.52
30_H	114_I	1.526	0.51
105_L	112_D	1.513	0.50
103_A	130_A	1.472	0.48
57_R	98_L	1.470	0.48
12_R	121_E	1.468	0.48
80_I	96_V	1.446	0.47
93_S	117_R	1.425	0.46
27_A	104_Y	1.423	0.46
8_Y	11_L	1.393	0.44
37_E	107_D	1.389	0.44
33_P	103_A	1.378	0.44
67_V	71_L	1.376	0.44
12_R	103_A	1.365	0.43
42_D	127_K	1.361	0.43
102_A	107_D	1.354	0.43
115_S	136_D	1.326	0.41
63_D	89_D	1.325	0.41
7_H	122_A	1.324	0.41
6_F	120_V	1.317	0.41
47_L	112_D	1.294	0.40
26_D	69_D	1.287	0.39
11_L	38_I	1.247	0.38
127_K	135_R	1.243	0.37
51_I	76_D	1.226	0.37
88_V	95_F	1.219	0.36
23_R	92_C	1.214	0.36
8_Y	57_R	1.206	0.36
22_S	69_D	1.178	0.34
119_K	130_A	1.167	0.34
32_L	55_S	1.165	0.34
114_I	123_Y	1.161	0.34
89_D	94_L	1.130	0.32
85_D	107_D	1.126	0.32
76_D	82_D	1.122	0.32
75_A	97_H	1.110	0.31
28_L	38_I	1.094	0.31
97_H	110_L	1.092	0.31
32_L	62_D	1.075	0.30
21_D	47_L	1.073	0.30
81_R	114_I	1.066	0.30
127_K	131_V	1.065	0.30
41_T	56_T	1.063	0.30
97_H	131_V	1.061	0.29
14_F	52_G	1.059	0.29
90_D	119_K	1.054	0.29
79_Q	83_Q	1.050	0.29
23_R	50_R	1.049	0.29
38_I	86_E	1.033	0.28
14_F	49_D	1.031	0.28
44_E	89_D	0.999	0.27
92_C	125_A	0.994	0.27
20_A	90_D	0.991	0.27
24_V	104_Y	0.988	0.27
47_L	86_E	0.973	0.26
12_R	28_L	0.971	0.26
6_F	38_I	0.969	0.26
49_D	137_A	0.968	0.26
13_V	33_P	0.951	0.25
17_D	80_I	0.942	0.25
75_A	95_F	0.942	0.25
113_G	123_Y	0.939	0.25
110_L	132_E	0.935	0.25
27_A	33_P	0.931	0.24
21_D	95_F	0.920	0.24
79_Q	110_L	0.919	0.24
23_R	62_D	0.913	0.24
51_I	107_D	0.912	0.24
39_E	112_D	0.910	0.24
12_R	55_S	0.909	0.24
132_E	136_D	0.907	0.24
56_T	120_V	0.904	0.24
11_L	116_L	0.904	0.24
59_E	67_V	0.875	0.23
33_P	109_Q	0.870	0.22
38_I	56_T	0.870	0.22
21_D	40_R	0.869	0.22
77_I	93_S	0.860	0.22
46_H	101_Q	0.851	0.22
75_A	81_R	0.849	0.22
30_H	103_A	0.824	0.21
14_F	53_V	0.814	0.21
39_E	83_Q	0.809	0.20
18_T	49_D	0.805	0.20
103_A	114_I	0.803	0.20
47_L	97_H	0.803	0.20
49_D	101_Q	0.798	0.20
24_V	27_A	0.779	0.19
13_V	40_R	0.778	0.19
81_R	107_D	0.774	0.19
43_S	64_M	0.772	0.19
111_G	117_R	0.760	0.19
99_D	134_A	0.757	0.19
9_I	82_D	0.752	0.19
73_D	116_L	0.741	0.18
110_L	136_D	0.740	0.18
119_K	124_P	0.733	0.18
114_I	125_A	0.733	0.18
21_D	99_D	0.727	0.18
38_I	87_R	0.725	0.18
14_F	122_A	0.723	0.18
129_A	132_E	0.713	0.17
90_D	94_L	0.713	0.17
10_D	57_R	0.689	0.17
54_L	73_D	0.688	0.17
28_L	48_G	0.685	0.17
53_V	77_I	0.685	0.17
27_A	95_F	0.684	0.17
103_A	128_D	0.684	0.17
86_E	120_V	0.679	0.17
55_S	121_E	0.679	0.17
123_Y	130_A	0.656	0.16
46_H	134_A	0.654	0.16
84_L	88_V	0.650	0.16
23_R	104_Y	0.646	0.16
57_R	130_A	0.643	0.16
78_E	119_K	0.642	0.16
72_R	98_L	0.641	0.16
82_D	99_D	0.634	0.15
9_I	104_Y	0.626	0.15
11_L	88_V	0.622	0.15
14_F	68_L	0.621	0.15
17_D	97_H	0.620	0.15
89_D	112_D	0.616	0.15
31_F	129_A	0.612	0.15
22_S	29_G	0.609	0.15
19_E	100_K	0.604	0.15
23_R	85_D	0.604	0.15
75_A	110_L	0.603	0.15
34_E	59_E	0.597	0.14
47_L	137_A	0.584	0.14
26_D	129_A	0.583	0.14
29_G	33_P	0.583	0.14
18_T	46_H	0.582	0.14
15_C	132_E	0.579	0.14
7_H	119_K	0.577	0.14
99_D	109_Q	0.576	0.14
10_D	117_R	0.573	0.14
16_Y	111_G	0.568	0.14
23_R	102_A	0.562	0.14
32_L	49_D	0.561	0.14
111_G	120_V	0.556	0.13
97_H	112_D	0.552	0.13
37_E	69_D	0.549	0.13
88_V	92_C	0.548	0.13
26_D	35_D	0.546	0.13
42_D	81_R	0.544	0.13
7_H	94_L	0.542	0.13
25_A	118_A	0.541	0.13
108_A	114_I	0.540	0.13
77_I	89_D	0.539	0.13
84_L	106_G	0.539	0.13
122_A	125_A	0.538	0.13
12_R	33_P	0.535	0.13
73_D	110_L	0.535	0.13
53_V	57_R	0.534	0.13
50_R	104_Y	0.532	0.13
17_D	82_D	0.530	0.13
111_G	126_K	0.527	0.13
38_I	76_D	0.525	0.13
55_S	78_E	0.522	0.13
80_I	97_H	0.520	0.13
99_D	110_L	0.520	0.13
71_L	92_C	0.519	0.13
60_R	63_D	0.516	0.13
43_S	53_V	0.516	0.13
43_S	46_H	0.515	0.13
16_Y	79_Q	0.510	0.12
76_D	79_Q	0.510	0.12
7_H	12_R	0.510	0.12
111_G	119_K	0.503	0.12
76_D	129_A	0.501	0.12
27_A	124_P	0.501	0.12
88_V	111_G	0.501	0.12
82_D	94_L	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2wnyA	1	0.9643	100	0.248	Contact Map
2ogkA	4	0.9714	100	0.275	Contact Map
2nrqA	1	0.9	100	0.285	Contact Map
3d7aA	2	0.8786	99.9	0.466	Contact Map
2pzzA	2	0.8571	99.9	0.502	Contact Map
2nwuA	2	0.8429	99.9	0.504	Contact Map
3c9gA	2	0.8357	99.9	0.534	Contact Map
4jbuA	1	0.9214	23.2	0.937	Contact Map
3f4mA	1	0.5786	17.2	0.941	Contact Map
1mw7A	1	0.5571	13.8	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.