Q9HQ69 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQ69 - Uncharacterized protein

UniProt:	Q9HQ69	Sequences: MEPNPAWDAESYPAVIEAFESLPADATVHVWGGDWCGDCRSQLPDFAAALAASGVEPAVHPVSRGDDGKTGPRVDEYGIDRIPTVVVEGADGTEHARFEERDSLPPERYLADALSD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	116 (100)
Sequences:	10823 (7243)
Seq/√Len:	724.3

ECOLI - THIO2 THIO YBBN
BACSU - THIO BDBA YTPP YDFQ YDBP YUSE YNEN
HALSA - Q9HQ69 O46709 Q9HMD0
SULSO - Q980E5 Q980T5 Q97WI4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_D	74_V	3.223	1.00
17_E	76_E	2.490	1.00
11_S	63_S	2.387	1.00
86_V	97_R	2.380	1.00
13_P	72_P	2.270	1.00
13_P	73_R	2.016	1.00
52_A	107_E	1.919	1.00
36_C	39_C	1.897	1.00
27_T	61_P	1.892	1.00
77_Y	88_E	1.891	1.00
66_D	69_K	1.882	1.00
67_D	82_I	1.843	1.00
30_V	64_R	1.836	1.00
94_E	97_R	1.774	1.00
25_D	61_P	1.765	1.00
53_S	107_E	1.757	1.00
107_E	111_A	1.727	1.00
46_F	62_V	1.679	1.00
45_D	48_A	1.675	1.00
86_V	94_E	1.675	1.00
13_P	70_T	1.656	1.00
105_P	108_R	1.652	1.00
26_A	87_V	1.629	1.00
15_V	19_F	1.553	1.00
98_F	102_D	1.537	1.00
28_V	46_F	1.505	1.00
34_D	66_D	1.496	1.00
49_A	62_V	1.488	1.00
53_S	111_A	1.469	1.00
19_F	61_P	1.437	1.00
49_A	107_E	1.417	1.00
28_V	85_V	1.409	1.00
101_R	105_P	1.393	1.00
27_T	63_S	1.385	1.00
11_S	19_F	1.359	1.00
9_A	19_F	1.358	1.00
12_Y	15_V	1.342	1.00
42_Q	85_V	1.337	1.00
12_Y	70_T	1.287	1.00
96_A	109_Y	1.262	1.00
42_Q	45_D	1.258	1.00
65_G	73_R	1.248	1.00
98_F	109_Y	1.241	1.00
17_E	21_S	1.204	1.00
87_V	109_Y	1.197	1.00
30_V	43_L	1.157	1.00
9_A	61_P	1.142	1.00
55_V	59_V	1.091	1.00
29_H	88_E	1.077	1.00
47_A	64_R	1.073	1.00
102_D	105_P	1.069	1.00
19_F	27_T	1.055	1.00
43_L	47_A	1.045	1.00
71_G	75_D	1.010	1.00
10_E	64_R	1.009	1.00
43_L	64_R	1.002	1.00
31_W	77_Y	0.935	1.00
49_A	53_S	0.927	1.00
32_G	64_R	0.913	1.00
32_G	66_D	0.887	1.00
42_Q	106_P	0.882	1.00
45_D	103_S	0.872	1.00
87_V	110_L	0.872	1.00
85_V	106_P	0.871	1.00
41_S	101_R	0.852	1.00
72_P	76_E	0.851	1.00
46_F	85_V	0.848	1.00
90_A	95_H	0.835	1.00
10_E	69_K	0.828	1.00
45_D	49_A	0.822	1.00
59_V	111_A	0.820	1.00
65_G	74_V	0.814	1.00
50_L	62_V	0.810	1.00
15_V	63_S	0.807	1.00
32_G	82_I	0.797	1.00
20_E	27_T	0.795	1.00
49_A	106_P	0.787	1.00
108_R	111_A	0.785	1.00
53_S	60_H	0.780	1.00
104_L	108_R	0.777	1.00
28_V	62_V	0.774	1.00
37_G	40_R	0.751	1.00
34_D	68_G	0.748	1.00
51_A	54_G	0.739	1.00
60_H	110_L	0.734	1.00
16_I	31_W	0.733	1.00
30_V	38_D	0.730	1.00
42_Q	102_D	0.726	1.00
16_I	20_E	0.726	1.00
31_W	79_I	0.720	1.00
31_W	86_V	0.717	1.00
30_V	42_Q	0.695	1.00
25_D	91_D	0.691	1.00
8_D	50_L	0.689	1.00
70_T	73_R	0.684	1.00
38_D	81_R	0.682	1.00
48_A	51_A	0.681	1.00
31_W	67_D	0.676	1.00
72_P	75_D	0.673	1.00
29_H	63_S	0.665	1.00
26_A	90_A	0.662	1.00
53_S	59_V	0.662	1.00
45_D	101_R	0.655	1.00
24_A	27_T	0.649	1.00
28_V	87_V	0.645	1.00
46_F	110_L	0.637	1.00
11_S	15_V	0.635	1.00
16_I	73_R	0.633	1.00
16_I	77_Y	0.629	1.00
42_Q	46_F	0.628	1.00
80_D	97_R	0.627	1.00
102_D	109_Y	0.622	1.00
73_R	76_E	0.618	1.00
42_Q	101_R	0.614	1.00
38_D	41_S	0.613	1.00
79_I	84_T	0.608	1.00
16_I	29_H	0.592	1.00
28_V	106_P	0.592	1.00
33_G	68_G	0.587	1.00
28_V	110_L	0.587	1.00
13_P	76_E	0.584	1.00
85_V	98_F	0.582	1.00
37_G	41_S	0.572	1.00
18_A	23_P	0.569	1.00
19_F	63_S	0.569	1.00
34_D	69_K	0.564	1.00
54_G	59_V	0.562	1.00
31_W	65_G	0.560	1.00
10_E	63_S	0.556	1.00
109_Y	112_D	0.556	1.00
24_A	91_D	0.555	1.00
11_S	29_H	0.554	1.00
25_D	59_V	0.550	1.00
15_V	18_A	0.548	1.00
33_G	36_C	0.546	1.00
71_G	74_V	0.545	1.00
10_E	32_G	0.543	1.00
65_G	70_T	0.542	1.00
34_D	40_R	0.536	1.00
67_D	79_I	0.536	1.00
81_R	99_E	0.533	1.00
35_W	40_R	0.531	1.00
92_G	95_H	0.524	1.00
39_C	44_P	0.521	1.00
46_F	106_P	0.518	1.00
8_D	46_F	0.514	1.00
35_W	68_G	0.506	1.00
88_E	94_E	0.502	0.99
9_A	27_T	0.501	0.99
9_A	63_S	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2r2jA	2	0.9138	99.8	0.204	Contact Map
3f8uA	2	0.9138	99.8	0.204	Contact Map
2b5eA	1	0.9655	99.8	0.21	Contact Map
3apoA	1	0.8879	99.8	0.213	Contact Map
4ekzA	1	0.9828	99.8	0.231	Contact Map
3ed3A	1	0.9655	99.8	0.25	Contact Map
1sjiA	2	0.9569	99.8	0.262	Contact Map
3us3A	2	0.9569	99.8	0.265	Contact Map
3t58A	1	1	99.7	0.286	Contact Map
3uemA	1	0.9741	99.7	0.287	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.