Q9HQ35 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQ35 - Uncharacterized protein

UniProt:	Q9HQ35	Sequences: MTMRLLVDNHFADTASYGAVGVDALRWPNPTFPGETLSVTVEVLEKTPSESKPDRGTVRTRVTTENEAGEPKLTMEPIVLYARHTPGEPT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	90 (72)
Sequences:	1091 (642)
Seq/√Len:	75.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_P	83_R	3.502	1.00
45_E	59_R	3.084	1.00
24_A	76_E	2.792	1.00
40_T	63_T	2.464	1.00
38_S	69_G	2.244	1.00
65_E	71_P	2.241	1.00
29_N	70_E	2.181	1.00
31_T	37_L	2.027	1.00
42_E	63_T	1.955	1.00
61_R	76_E	1.951	1.00
31_T	72_K	1.801	1.00
54_D	83_R	1.761	1.00
63_T	71_P	1.742	1.00
66_N	70_E	1.642	1.00
52_K	55_R	1.449	0.99
16_S	79_V	1.431	0.99
60_T	79_V	1.403	0.99
35_E	67_E	1.388	0.99
62_V	75_M	1.388	0.99
26_R	74_T	1.388	0.99
39_V	64_T	1.372	0.98
61_R	74_T	1.368	0.98
42_E	61_R	1.367	0.98
64_T	73_L	1.345	0.98
16_S	81_Y	1.240	0.97
24_A	74_T	1.197	0.96
67_E	72_K	1.188	0.96
35_E	66_N	1.182	0.96
17_Y	55_R	1.170	0.96
44_L	61_R	1.131	0.95
40_T	65_E	1.131	0.95
49_S	52_K	1.051	0.93
41_V	60_T	1.040	0.92
14_T	81_Y	1.024	0.92
19_A	77_P	1.024	0.92
28_P	71_P	0.998	0.91
62_V	79_V	0.987	0.90
43_V	58_V	0.976	0.90
59_R	78_I	0.976	0.90
64_T	75_M	0.970	0.89
35_E	72_K	0.965	0.89
39_V	62_V	0.954	0.88
55_R	80_L	0.927	0.87
23_D	59_R	0.927	0.87
37_L	64_T	0.926	0.87
20_V	77_P	0.925	0.87
41_V	62_V	0.922	0.87
19_A	22_V	0.900	0.85
27_W	33_P	0.873	0.84
22_V	27_W	0.837	0.81
63_T	74_T	0.832	0.80
59_R	76_E	0.810	0.79
57_T	78_I	0.803	0.78
23_D	78_I	0.798	0.78
47_T	78_I	0.793	0.77
65_E	69_G	0.776	0.76
44_L	76_E	0.762	0.74
57_T	80_L	0.732	0.71
16_S	60_T	0.725	0.71
27_W	73_L	0.718	0.70
18_G	81_Y	0.711	0.69
37_L	72_K	0.701	0.68
60_T	77_P	0.697	0.68
71_P	74_T	0.685	0.66
16_S	33_P	0.680	0.66
47_T	53_P	0.680	0.66
16_S	22_V	0.672	0.65
36_T	72_K	0.664	0.64
49_S	57_T	0.656	0.63
22_V	75_M	0.654	0.63
43_V	60_T	0.651	0.62
49_S	78_I	0.646	0.62
47_T	50_E	0.645	0.62
38_S	65_E	0.644	0.62
29_N	66_N	0.644	0.62
15_A	79_V	0.637	0.61
25_L	75_M	0.631	0.60
20_V	57_T	0.624	0.59
35_E	38_S	0.622	0.59
55_R	82_A	0.617	0.58
36_T	41_V	0.616	0.58
17_Y	82_A	0.614	0.58
65_E	84_H	0.611	0.57
20_V	80_L	0.594	0.55
22_V	55_R	0.591	0.55
47_T	51_S	0.589	0.55
49_S	53_P	0.573	0.53
37_L	65_E	0.569	0.52
54_D	85_T	0.565	0.52
58_V	77_P	0.564	0.52
45_E	76_E	0.558	0.51
29_N	71_P	0.554	0.50
14_T	47_T	0.552	0.50
58_V	68_A	0.550	0.50
52_K	57_T	0.542	0.49
33_P	37_L	0.537	0.48
47_T	57_T	0.537	0.48
26_R	46_K	0.536	0.48
19_A	27_W	0.531	0.47
21_G	31_T	0.519	0.46
39_V	83_R	0.516	0.46
15_A	82_A	0.513	0.45
58_V	83_R	0.511	0.45
23_D	76_E	0.507	0.44
55_R	83_R	0.505	0.44
15_A	18_G	0.505	0.44
28_P	74_T	0.501	0.44
62_V	81_Y	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bi0A	3	0.8444	99.5	0.544	Contact Map
4e3eA	3	0.9111	99.5	0.568	Contact Map
4ffuA	6	0.9667	99.4	0.587	Contact Map
1q6wA	6	0.9222	99.4	0.588	Contact Map
3exzA	2	0.9333	99.3	0.593	Contact Map
4w78A	2	0.9556	99	0.653	Contact Map
4v12A	2	0.9556	99	0.656	Contact Map
3ir3A	2	0.8556	98.8	0.674	Contact Map
4rv2A	2	0.8111	98.8	0.679	Contact Map
2c2iA	2	0.8889	98.7	0.684	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.