Q9HQ33 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQ33 - Transcription regulator

UniProt:	Q9HQ33	Sequences: MDDRDITILKAIADLGTGSPEALQEETGIPVSTIHYRLNNLRDDGVITNDLYDINPDSIGLDVTVVLEVLTSYDGGYEDVADEISAVEGVTQTFFTMGETDFVVVARLPGSDDVERLISDFEALDPVDRTNSTFVIDRHKDAQRALESYSLDSLVTALADE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	161 (140)
Sequences:	13437 (8852)
Seq/√Len:	748.1

ECOLI - YBAO LRP ASNC
BACSU - AZLB YUGG YWRC LRPB LRPC YEZC LRPA
HALSA - Q9HQ33 Q9HNI1 Q9HQ13 Q9HQB6 Q9HP41 Q9HQG1 Q9HNW8 Q9HP70
SULSO - Q7LXS6 Q97W90 Q7LX67 Q97XP7 LYSM Q97X78 Q980P3 Q97VN7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_R	50_D	2.916	1.00
11_A	26_E	2.915	1.00
70_L	129_R	2.507	1.00
92_Q	105_V	2.506	1.00
99_E	131_N	2.494	1.00
109_P	113_D	2.260	1.00
20_P	38_L	2.258	1.00
57_D	112_D	2.105	1.00
48_T	55_N	2.044	1.00
11_A	18_G	2.031	1.00
40_N	44_D	2.003	1.00
5_D	37_R	1.899	1.00
72_S	128_D	1.891	1.00
87_V	120_D	1.890	1.00
64_T	105_V	1.858	1.00
91_T	107_R	1.797	1.00
48_T	53_D	1.786	1.00
18_G	26_E	1.771	1.00
66_V	94_F	1.756	1.00
4_R	29_I	1.694	1.00
87_V	117_L	1.681	1.00
29_I	33_T	1.672	1.00
68_E	133_T	1.666	1.00
39_N	43_D	1.643	1.00
11_A	14_D	1.641	1.00
83_E	124_L	1.629	1.00
21_E	25_E	1.572	1.00
110_G	113_D	1.572	1.00
22_A	25_E	1.534	1.00
80_V	84_I	1.476	1.00
21_E	31_V	1.472	1.00
113_D	116_R	1.467	1.00
29_I	34_I	1.454	1.00
89_G	113_D	1.451	1.00
30_P	33_T	1.438	1.00
8_I	23_L	1.417	1.00
27_T	34_I	1.416	1.00
83_E	86_A	1.408	1.00
20_P	35_H	1.383	1.00
69_V	104_V	1.374	1.00
81_A	85_S	1.363	1.00
17_T	50_D	1.352	1.00
68_E	100_T	1.349	1.00
67_L	106_A	1.337	1.00
3_D	7_T	1.333	1.00
138_R	141_D	1.325	1.00
22_A	26_E	1.303	1.00
70_L	99_E	1.295	1.00
116_R	119_S	1.284	1.00
12_I	38_L	1.280	1.00
61_L	109_P	1.258	1.00
89_G	120_D	1.255	1.00
18_G	23_L	1.250	1.00
63_V	111_S	1.245	1.00
70_L	128_D	1.219	1.00
78_E	82_D	1.217	1.00
81_A	137_D	1.201	1.00
18_G	22_A	1.191	1.00
39_N	42_R	1.185	1.00
4_R	7_T	1.180	1.00
15_L	26_E	1.179	1.00
76_G	79_D	1.170	1.00
19_S	22_A	1.163	1.00
115_E	137_D	1.143	1.00
14_D	26_E	1.142	1.00
11_A	23_L	1.117	1.00
71_T	80_V	1.108	1.00
68_E	131_N	1.104	1.00
49_N	53_D	1.101	1.00
4_R	27_T	1.096	1.00
15_L	18_G	1.054	1.00
7_T	11_A	1.048	1.00
64_T	107_R	1.032	1.00
7_T	10_K	1.030	1.00
90_V	106_A	1.028	1.00
108_L	114_V	1.006	1.00
2_D	37_R	1.000	1.00
81_A	102_F	0.993	1.00
16_G	50_D	0.991	1.00
17_T	42_R	0.987	1.00
20_P	24_Q	0.985	1.00
79_D	83_E	0.983	1.00
93_T	104_V	0.983	1.00
7_T	27_T	0.975	1.00
66_V	103_V	0.970	1.00
96_T	103_V	0.961	1.00
108_L	113_D	0.960	1.00
24_Q	34_I	0.949	1.00
94_F	105_V	0.942	1.00
106_A	117_L	0.940	1.00
35_H	39_N	0.930	1.00
10_K	14_D	0.925	1.00
108_L	117_L	0.914	1.00
20_P	31_V	0.909	1.00
99_E	129_R	0.908	1.00
82_D	85_S	0.905	1.00
55_N	58_S	0.902	1.00
62_D	110_G	0.898	1.00
66_V	105_V	0.894	1.00
31_V	35_H	0.888	1.00
24_Q	29_I	0.883	1.00
82_D	86_A	0.851	1.00
41_L	46_V	0.847	1.00
1_M	6_I	0.839	1.00
94_F	135_V	0.839	1.00
16_G	52_Y	0.821	1.00
56_P	107_R	0.813	1.00
90_V	93_T	0.808	1.00
84_I	93_T	0.807	1.00
66_V	135_V	0.806	1.00
90_V	104_V	0.794	1.00
21_E	35_H	0.790	1.00
5_D	40_N	0.789	1.00
32_S	36_Y	0.784	1.00
77_Y	102_F	0.777	1.00
83_E	87_V	0.774	1.00
68_E	103_V	0.773	1.00
94_F	138_R	0.772	1.00
118_I	132_S	0.771	1.00
122_E	130_T	0.764	1.00
23_L	38_L	0.760	1.00
100_T	131_N	0.749	1.00
69_V	80_V	0.747	1.00
6_I	10_K	0.744	1.00
97_M	134_F	0.743	1.00
23_L	34_I	0.738	1.00
72_S	126_P	0.734	1.00
76_G	123_A	0.733	1.00
81_A	139_H	0.733	1.00
68_E	99_E	0.729	1.00
79_D	82_D	0.727	1.00
78_E	81_A	0.726	1.00
116_R	120_D	0.725	1.00
36_Y	40_N	0.707	1.00
8_I	34_I	0.702	1.00
8_I	37_R	0.698	1.00
61_L	107_R	0.693	1.00
46_V	58_S	0.692	1.00
65_V	114_V	0.679	1.00
70_L	100_T	0.678	1.00
84_I	104_V	0.678	1.00
89_G	109_P	0.667	1.00
111_S	134_F	0.664	1.00
95_F	102_F	0.656	1.00
3_D	6_I	0.656	1.00
24_Q	31_V	0.655	1.00
11_A	15_L	0.651	1.00
8_I	11_A	0.650	1.00
67_L	130_T	0.650	1.00
89_G	117_L	0.643	1.00
87_V	124_L	0.641	1.00
79_D	125_D	0.640	1.00
112_D	115_E	0.639	1.00
61_L	89_G	0.638	1.00
65_V	134_F	0.638	1.00
8_I	38_L	0.636	1.00
64_T	138_R	0.636	1.00
80_V	102_F	0.622	1.00
79_D	126_P	0.620	1.00
32_S	35_H	0.620	1.00
96_T	100_T	0.616	1.00
112_D	116_R	0.615	1.00
5_D	41_L	0.615	1.00
9_L	41_L	0.615	1.00
14_D	18_G	0.613	1.00
72_S	75_G	0.612	1.00
118_I	130_T	0.612	1.00
55_N	59_I	0.611	1.00
120_D	124_L	0.610	1.00
8_I	18_G	0.607	1.00
37_R	41_L	0.605	1.00
64_T	135_V	0.604	1.00
16_G	49_N	0.602	1.00
67_L	104_V	0.599	1.00
20_P	34_I	0.599	1.00
54_I	59_I	0.598	1.00
70_L	131_N	0.595	1.00
113_D	117_L	0.595	1.00
83_E	125_D	0.580	1.00
111_S	136_I	0.578	1.00
117_L	121_F	0.575	1.00
36_Y	39_N	0.575	1.00
117_L	120_D	0.573	1.00
78_E	123_A	0.573	1.00
45_G	48_T	0.572	1.00
2_D	5_D	0.561	1.00
96_T	135_V	0.559	1.00
47_I	50_D	0.558	1.00
1_M	46_V	0.552	1.00
95_F	122_E	0.546	1.00
65_V	132_S	0.544	1.00
92_Q	141_D	0.544	1.00
8_I	41_L	0.542	1.00
69_V	127_V	0.541	1.00
64_T	94_F	0.538	1.00
21_E	24_Q	0.538	1.00
69_V	130_T	0.531	1.00
114_V	134_F	0.529	1.00
96_T	133_T	0.528	1.00
10_K	13_A	0.522	1.00
4_R	33_T	0.519	1.00
15_L	22_A	0.514	1.00
97_M	136_I	0.511	1.00
95_F	136_I	0.511	1.00
40_N	43_D	0.509	1.00
13_A	51_L	0.509	1.00
93_T	139_H	0.507	1.00
71_T	101_D	0.506	1.00
122_E	129_R	0.506	1.00
53_D	56_P	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ch7A	1	0.9503	100	0.158	Contact Map
4un1B	1	0.913	100	0.215	Contact Map
4un1A	1	0.8758	100	0.222	Contact Map
2e1cA	1	0.9068	100	0.232	Contact Map
4pcqA	2	0.8944	100	0.242	Contact Map
2p5vA	5	0.9379	100	0.245	Contact Map
2ia0A	2	0.913	100	0.254	Contact Map
2cg4A	6	0.9068	100	0.264	Contact Map
2pn6A	5	0.913	100	0.27	Contact Map
3i4pA	5	0.9317	100	0.275	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.