Q9HQ28 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQ28 - Uncharacterized protein

UniProt:	Q9HQ28	Sequences: MDLADIEARIEAGFEADCSATVSRARGPHDDDHLEAVVVSPAFEGVSLVDQHDMVYDALGDAMTTEIHALELTTRPRSDRDA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	82 (72)
Sequences:	677 (342)
Seq/√Len:	40.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
41_P	44_E	3.821	1.00
46_V	50_D	3.818	1.00
22_V	34_L	2.608	1.00
7_E	11_E	2.582	1.00
46_V	54_M	2.426	1.00
24_R	27_G	2.423	1.00
62_A	66_E	2.267	1.00
47_S	50_D	2.206	0.99
56_Y	63_M	2.067	0.99
4_A	7_E	2.055	0.99
49_V	53_D	1.851	0.98
17_D	40_S	1.691	0.97
42_A	54_M	1.603	0.96
38_V	72_L	1.552	0.95
21_T	37_V	1.543	0.95
11_E	20_A	1.539	0.94
23_S	35_E	1.459	0.93
6_I	67_I	1.427	0.92
27_G	32_D	1.393	0.91
12_A	60_G	1.369	0.90
10_I	14_F	1.338	0.89
44_E	78_S	1.262	0.86
37_V	75_R	1.242	0.85
37_V	73_T	1.173	0.82
13_G	58_A	1.167	0.81
22_V	31_D	1.166	0.81
53_D	57_D	1.145	0.80
9_R	62_A	1.140	0.80
24_R	32_D	1.131	0.79
8_A	12_A	1.107	0.78
3_L	34_L	1.044	0.73
51_Q	75_R	1.026	0.72
24_R	30_D	1.008	0.71
6_I	34_L	1.006	0.70
31_D	71_E	1.005	0.70
4_A	8_A	0.988	0.69
61_D	64_T	0.976	0.68
31_D	34_L	0.968	0.67
39_V	76_P	0.952	0.66
5_D	9_R	0.940	0.65
60_G	64_T	0.922	0.64
10_I	20_A	0.920	0.63
5_D	8_A	0.920	0.63
23_S	37_V	0.914	0.63
24_R	34_L	0.892	0.61
48_L	64_T	0.884	0.60
48_L	51_Q	0.830	0.55
51_Q	74_T	0.819	0.54
35_E	73_T	0.816	0.54
34_L	67_I	0.805	0.53
39_V	77_R	0.805	0.53
17_D	42_A	0.793	0.52
8_A	19_S	0.786	0.51
8_A	78_S	0.779	0.51
42_A	52_H	0.775	0.50
5_D	35_E	0.761	0.49
54_M	57_D	0.756	0.49
9_R	20_A	0.756	0.49
27_G	63_M	0.748	0.48
17_D	20_A	0.744	0.48
11_E	17_D	0.687	0.42
11_E	41_P	0.679	0.42
40_S	76_P	0.678	0.42
23_S	73_T	0.668	0.41
51_Q	72_L	0.668	0.41
63_M	66_E	0.666	0.41
57_D	66_E	0.662	0.40
56_Y	61_D	0.648	0.39
24_R	31_D	0.632	0.38
10_I	38_V	0.628	0.37
8_A	45_G	0.627	0.37
16_A	41_P	0.625	0.37
60_G	63_M	0.616	0.36
50_D	53_D	0.613	0.36
21_T	39_V	0.613	0.36
51_Q	58_A	0.612	0.36
5_D	50_D	0.608	0.36
59_L	63_M	0.606	0.35
59_L	75_R	0.602	0.35
48_L	53_D	0.593	0.34
40_S	52_H	0.590	0.34
19_S	47_S	0.586	0.34
34_L	61_D	0.582	0.33
44_E	76_P	0.581	0.33
8_A	42_A	0.580	0.33
56_Y	67_I	0.577	0.33
56_Y	60_G	0.575	0.33
17_D	41_P	0.575	0.33
38_V	58_A	0.573	0.33
16_A	42_A	0.572	0.33
18_C	58_A	0.571	0.32
2_D	8_A	0.565	0.32
3_L	39_V	0.564	0.32
2_D	5_D	0.563	0.32
2_D	31_D	0.550	0.31
40_S	53_D	0.538	0.30
32_D	66_E	0.536	0.30
41_P	77_R	0.534	0.30
6_I	14_F	0.532	0.29
56_Y	65_T	0.524	0.29
7_E	19_S	0.522	0.29
34_L	70_L	0.520	0.28
39_V	44_E	0.518	0.28
14_F	37_V	0.515	0.28
56_Y	70_L	0.514	0.28
40_S	54_M	0.504	0.27
48_L	65_T	0.500	0.27
60_G	75_R	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3tr3A	2	0.939	99.9	0.307	Contact Map
3o2eA	2	0.9634	99.9	0.308	Contact Map
2kdnA	1	0.9634	99.9	0.309	Contact Map
1xs3A	1	0.9146	99.9	0.312	Contact Map
2dhmA	1	0.9634	99.9	0.313	Contact Map
2mm9A	1	0.9634	99.9	0.315	Contact Map
1v9jA	1	0.9756	99.9	0.316	Contact Map
1ny8A	1	0.9268	99.9	0.318	Contact Map
1v60A	1	0.9634	99.9	0.33	Contact Map
2mcqA	1	0.9146	99.9	0.334	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.