Q9HQ06 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQ06 - Acetyltransferase homolog

UniProt:	Q9HQ06	Sequences: MTARPDSSGASSRHDRLQRHPTPNARNSLWRWTDAKHPLRVALNYVVIVLARISPSLHAKNWLLARIGVTVGDGVAWGLESTPDVFWPELVTVGDDAIIGYDATLLCHEFLHDEYRTGAVVVEDRAMIGAGAVVLPGVTIGADAQVAANSLVTADVPPGETVAGVPAAPTGD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	172 (147)
Sequences:	5084 (3686)
Seq/√Len:	304.0

ECOLI - WCAF THGA MAA WBBJ WCAB CAIE YRDA PAAY CYSE YAIX LPXD
BACSU - YVOF MAA CYSE EPSM DAPH YTOA
HALSA - Q9HQ06 Q9HPT3 Q9HNN1
SULSO - Q980E1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
83_P	91_V	3.337	1.00
143_D	159_G	3.145	1.00
105_L	120_V	3.029	1.00
123_E	142_A	2.903	1.00
74_G	96_D	2.814	1.00
156_V	162_V	2.504	1.00
125_R	143_D	2.496	1.00
142_A	158_P	2.490	1.00
70_T	92_T	2.484	1.00
147_A	163_A	2.462	1.00
80_E	102_D	2.406	1.00
163_A	170_T	2.362	1.00
124_D	142_A	2.323	1.00
52_R	70_T	2.287	1.00
135_L	148_A	2.248	1.00
73_D	95_D	2.079	1.00
92_T	121_V	2.077	1.00
30_W	34_D	1.996	1.00
106_L	130_A	1.946	1.00
144_A	160_E	1.875	1.00
144_A	158_P	1.826	1.00
115_Y	118_G	1.779	1.00
128_I	134_V	1.759	1.00
54_S	73_D	1.712	1.00
96_D	125_R	1.710	1.00
150_S	167_A	1.695	1.00
162_V	167_A	1.691	1.00
38_P	41_V	1.664	1.00
121_V	139_T	1.647	1.00
43_L	47_V	1.624	1.00
72_G	95_D	1.535	1.00
160_E	169_P	1.503	1.00
144_A	156_V	1.448	1.00
71_V	75_V	1.441	1.00
146_V	156_V	1.433	1.00
53_I	57_L	1.430	1.00
95_D	124_D	1.429	1.00
123_E	139_T	1.410	1.00
24_N	28_S	1.393	1.00
75_V	95_D	1.388	1.00
128_I	132_A	1.385	1.00
99_I	105_L	1.382	1.00
70_T	90_L	1.349	1.00
27_N	37_H	1.331	1.00
162_V	169_P	1.315	1.00
105_L	122_V	1.309	1.00
30_W	36_K	1.250	1.00
77_W	81_S	1.242	1.00
31_R	36_K	1.238	1.00
88_P	117_T	1.237	1.00
27_N	36_K	1.225	1.00
104_T	131_G	1.173	1.00
56_S	74_G	1.172	1.00
89_E	117_T	1.152	1.00
139_T	155_D	1.151	1.00
126_A	144_A	1.143	1.00
146_V	162_V	1.135	1.00
102_D	131_G	1.129	1.00
94_G	124_D	1.125	1.00
25_A	29_L	1.123	1.00
82_T	102_D	1.111	1.00
157_P	162_V	1.111	1.00
97_A	142_A	1.107	1.00
135_L	153_T	1.102	1.00
110_F	161_T	1.101	1.00
28_S	48_I	1.087	1.00
157_P	169_P	1.087	1.00
111_L	114_E	1.082	1.00
97_A	124_D	1.047	1.00
93_V	99_I	1.042	1.00
122_V	128_I	1.036	1.00
41_V	44_N	1.015	1.00
132_A	150_S	1.008	1.00
110_F	145_Q	0.991	1.00
126_A	158_P	0.985	1.00
75_V	97_A	0.981	1.00
77_W	83_P	0.980	1.00
71_V	77_W	0.974	1.00
142_A	159_G	0.973	1.00
138_V	155_D	0.968	1.00
99_I	128_I	0.961	1.00
75_V	124_D	0.959	1.00
25_A	49_V	0.957	1.00
157_P	160_E	0.949	1.00
93_V	97_A	0.934	1.00
55_P	73_D	0.924	1.00
104_T	130_A	0.913	1.00
126_A	142_A	0.902	1.00
103_A	132_A	0.899	1.00
23_P	26_R	0.894	1.00
123_E	158_P	0.889	1.00
45_Y	49_V	0.877	1.00
104_T	133_V	0.870	1.00
60_K	76_A	0.867	1.00
93_V	105_L	0.862	1.00
146_V	152_V	0.857	1.00
133_V	149_N	0.850	1.00
77_W	99_I	0.846	1.00
151_L	165_V	0.845	1.00
150_S	165_V	0.843	1.00
27_N	30_W	0.839	1.00
149_N	165_V	0.839	1.00
65_A	69_V	0.830	1.00
105_L	134_V	0.830	1.00
99_I	103_A	0.829	1.00
71_V	93_V	0.824	1.00
123_E	144_A	0.819	1.00
140_I	146_V	0.817	1.00
57_L	75_V	0.806	1.00
122_V	126_A	0.803	1.00
120_V	136_P	0.800	1.00
47_V	53_I	0.795	1.00
28_S	31_R	0.789	1.00
28_S	49_V	0.777	0.99
134_V	140_I	0.777	0.99
145_Q	161_T	0.760	0.99
155_D	162_V	0.759	0.99
50_L	53_I	0.759	0.99
93_V	122_V	0.754	0.99
63_L	69_V	0.746	0.99
138_V	154_A	0.740	0.99
69_V	83_P	0.736	0.99
160_E	163_A	0.731	0.99
27_N	31_R	0.727	0.99
26_R	60_K	0.725	0.99
32_W	46_V	0.723	0.99
66_R	88_P	0.722	0.99
94_G	121_V	0.720	0.99
23_P	39_L	0.714	0.99
40_R	44_N	0.713	0.99
64_L	79_L	0.710	0.99
39_L	43_L	0.700	0.99
28_S	45_Y	0.700	0.99
25_A	28_S	0.685	0.99
24_N	27_N	0.673	0.98
97_A	126_A	0.671	0.98
26_R	79_L	0.670	0.98
26_R	30_W	0.667	0.98
109_E	114_E	0.665	0.98
44_N	48_I	0.665	0.98
56_S	73_D	0.664	0.98
62_W	66_R	0.657	0.98
131_G	149_N	0.657	0.98
23_P	37_H	0.648	0.98
53_I	73_D	0.646	0.98
163_A	167_A	0.646	0.98
23_P	27_N	0.645	0.98
140_I	156_V	0.644	0.98
75_V	93_V	0.643	0.98
51_A	54_S	0.641	0.98
103_A	128_I	0.633	0.98
57_L	71_V	0.631	0.98
118_G	137_G	0.627	0.98
28_S	32_W	0.626	0.97
92_T	119_A	0.623	0.97
81_S	103_A	0.623	0.97
31_R	35_A	0.623	0.97
30_W	37_H	0.623	0.97
163_A	168_A	0.617	0.97
147_A	161_T	0.616	0.97
47_V	51_A	0.612	0.97
35_A	45_Y	0.608	0.97
31_R	34_D	0.606	0.97
94_G	97_A	0.603	0.97
140_I	155_D	0.597	0.97
125_R	142_A	0.596	0.97
69_V	85_V	0.595	0.97
42_A	47_V	0.595	0.97
25_A	33_T	0.593	0.97
101_Y	130_A	0.588	0.96
32_W	45_Y	0.587	0.96
27_N	34_D	0.587	0.96
23_P	30_W	0.585	0.96
140_I	152_V	0.581	0.96
90_L	119_A	0.580	0.96
141_G	158_P	0.579	0.96
30_W	35_A	0.579	0.96
31_R	48_I	0.578	0.96
78_G	127_M	0.577	0.96
62_W	65_A	0.575	0.96
130_A	133_V	0.571	0.96
143_D	158_P	0.569	0.96
36_K	39_L	0.566	0.96
94_G	123_E	0.565	0.95
161_T	171_G	0.564	0.95
32_W	61_N	0.562	0.95
48_I	51_A	0.561	0.95
63_L	81_S	0.558	0.95
35_A	38_P	0.556	0.95
25_A	32_W	0.555	0.95
51_A	70_T	0.555	0.95
72_G	75_V	0.551	0.95
140_I	144_A	0.549	0.95
32_W	35_A	0.549	0.95
47_V	55_P	0.547	0.95
108_H	112_H	0.542	0.94
29_L	65_A	0.539	0.94
39_L	42_A	0.538	0.94
42_A	61_N	0.537	0.94
35_A	41_V	0.537	0.94
75_V	99_I	0.536	0.94
140_I	162_V	0.534	0.94
84_D	101_Y	0.533	0.94
42_A	45_Y	0.528	0.94
54_S	57_L	0.526	0.93
83_P	105_L	0.525	0.93
109_E	112_H	0.525	0.93
133_V	151_L	0.523	0.93
24_N	48_I	0.523	0.93
79_L	84_D	0.521	0.93
89_E	107_C	0.517	0.93
46_V	50_L	0.513	0.93
106_L	133_V	0.509	0.92
90_L	121_V	0.509	0.92
32_W	42_A	0.508	0.92
156_V	167_A	0.508	0.92
64_L	80_E	0.507	0.92
133_V	165_V	0.506	0.92
99_I	122_V	0.501	0.92
29_L	36_K	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3srtA	3	0.9826	100	0.3	Contact Map
3fttA	3	0.9884	100	0.304	Contact Map
2p2oA	3	0.9826	100	0.319	Contact Map
1krrA	3	0.9884	100	0.319	Contact Map
3hjjA	3	0.9826	100	0.32	Contact Map
3nz2A	4	0.9767	100	0.323	Contact Map
1ocxA	3	0.9767	100	0.332	Contact Map
3vbiA	3	0.7733	99.9	0.421	Contact Map
4mzuA	5	0.7442	99.9	0.442	Contact Map
2v0hA	3	0.9709	99.9	0.445	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.