Y1401 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y1401 - UPF0179 protein VNG_1401C

UniProt:	Q9HPZ6	Sequences: MPITLLGPRLADPGTEFVYHGPADDCEGCPYRQQCLNLTEGVRYEVTDVREGGQVLDCAVHDEGAVAVDVEPTTIPATVPSKGAYAGSKGKLAGPCPHTECPSHEFCEPAGASFDTEYQIAEIDGEPPHDHCALDRDLTLVEFAPAER	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	148 (138)
Sequences:	137 (101)
Seq/√Len:	8.6

HALSA - Y1401

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
101_C	107_C	3.899	0.98
101_C	132_C	2.882	0.87
80_P	93_A	2.742	0.85
56_L	78_T	2.674	0.83
13_P	48_D	2.480	0.78
81_S	140_L	2.393	0.75
27_E	63_E	2.182	0.68
61_H	109_P	2.141	0.66
60_V	112_A	2.065	0.63
61_H	68_V	1.952	0.59
22_P	64_G	1.896	0.56
42_V	120_I	1.833	0.54
23_A	69_D	1.831	0.54
30_P	78_T	1.760	0.51
39_T	42_V	1.757	0.51
93_A	143_F	1.726	0.49
25_D	46_V	1.672	0.47
12_D	115_D	1.632	0.45
79_V	84_A	1.630	0.45
24_D	46_V	1.611	0.44
62_D	67_A	1.570	0.43
77_A	143_F	1.568	0.43
4_T	61_H	1.550	0.42
37_N	100_E	1.534	0.41
12_D	140_L	1.516	0.40
19_Y	118_Y	1.515	0.40
10_L	73_T	1.504	0.40
10_L	88_S	1.494	0.40
32_R	86_A	1.491	0.39
9_R	22_P	1.450	0.38
32_R	125_G	1.433	0.37
95_P	120_I	1.398	0.36
107_C	132_C	1.387	0.35
8_P	66_V	1.368	0.35
83_G	117_E	1.359	0.34
4_T	11_A	1.346	0.34
64_G	104_H	1.329	0.33
73_T	124_D	1.303	0.32
46_V	69_D	1.299	0.32
33_Q	110_A	1.295	0.32
86_A	122_E	1.294	0.32
20_H	110_A	1.275	0.31
34_Q	77_A	1.268	0.31
106_F	140_L	1.263	0.31
125_G	128_P	1.261	0.31
118_Y	138_L	1.258	0.30
20_H	30_P	1.258	0.30
115_D	123_I	1.252	0.30
82_K	115_D	1.250	0.30
23_A	89_K	1.249	0.30
46_V	49_V	1.232	0.29
25_D	92_L	1.218	0.29
16_E	50_R	1.212	0.29
12_D	143_F	1.199	0.28
22_P	37_N	1.184	0.28
6_L	13_P	1.175	0.28
39_T	116_T	1.158	0.27
82_K	86_A	1.154	0.27
45_E	71_E	1.150	0.27
98_H	105_E	1.143	0.26
52_G	62_D	1.123	0.26
12_D	48_D	1.117	0.26
55_V	64_G	1.115	0.26
3_I	106_F	1.110	0.25
10_L	111_G	1.105	0.25
41_G	79_V	1.100	0.25
16_E	96_C	1.081	0.24
42_V	116_T	1.077	0.24
63_E	123_I	1.075	0.24
16_E	64_G	1.071	0.24
43_R	59_A	1.056	0.24
32_R	81_S	1.049	0.23
33_Q	52_G	1.037	0.23
20_H	82_K	1.033	0.23
91_K	112_A	1.027	0.23
48_D	69_D	1.021	0.23
47_T	71_E	1.019	0.23
8_P	55_V	1.000	0.22
14_G	116_T	0.998	0.22
12_D	18_V	0.997	0.22
106_F	117_E	0.997	0.22
19_Y	136_R	0.977	0.21
18_V	102_P	0.969	0.21
16_E	47_T	0.966	0.21
19_Y	91_K	0.962	0.21
6_L	108_E	0.959	0.21
16_E	43_R	0.950	0.21
122_E	144_A	0.939	0.20
19_Y	57_D	0.938	0.20
38_L	70_V	0.937	0.20
46_V	51_E	0.935	0.20
61_H	138_L	0.932	0.20
49_V	137_D	0.923	0.20
9_R	62_D	0.910	0.19
9_R	120_I	0.899	0.19
74_T	142_E	0.890	0.19
15_T	89_K	0.883	0.19
96_C	99_T	0.881	0.19
14_G	111_G	0.879	0.19
22_P	36_L	0.872	0.18
30_P	110_A	0.847	0.18
33_Q	113_S	0.846	0.18
86_A	133_A	0.844	0.18
19_Y	59_A	0.843	0.18
49_V	74_T	0.843	0.18
13_P	88_S	0.842	0.18
60_V	98_H	0.836	0.18
48_D	144_A	0.835	0.18
61_H	75_I	0.834	0.18
3_I	39_T	0.833	0.17
74_T	93_A	0.833	0.17
45_E	119_Q	0.828	0.17
43_R	57_D	0.821	0.17
104_H	108_E	0.821	0.17
51_E	55_V	0.819	0.17
88_S	125_G	0.816	0.17
65_A	71_E	0.815	0.17
61_H	111_G	0.810	0.17
66_V	88_S	0.798	0.17
6_L	15_T	0.793	0.17
79_V	139_T	0.792	0.17
120_I	142_E	0.792	0.17
122_E	126_E	0.792	0.17
34_Q	72_P	0.785	0.16
24_D	110_A	0.777	0.16
69_D	73_T	0.772	0.16
109_P	141_V	0.768	0.16
10_L	22_P	0.768	0.16
24_D	114_F	0.764	0.16
91_K	122_E	0.763	0.16
3_I	87_G	0.762	0.16
19_Y	50_R	0.759	0.16
107_C	138_L	0.745	0.15
39_T	118_Y	0.742	0.15
7_G	61_H	0.741	0.15
13_P	76_P	0.730	0.15
19_Y	121_A	0.723	0.15
42_V	105_E	0.721	0.15
3_I	6_L	0.719	0.15
8_P	91_K	0.719	0.15
63_E	121_A	0.716	0.15
41_G	96_C	0.715	0.15
28_G	59_A	0.714	0.15
84_A	141_V	0.705	0.15
16_E	21_G	0.703	0.15
91_K	118_Y	0.689	0.14
66_V	126_E	0.677	0.14
68_V	139_T	0.672	0.14
3_I	57_D	0.671	0.14
25_D	104_H	0.670	0.14
75_I	111_G	0.669	0.14
117_E	126_E	0.662	0.14
56_L	84_A	0.657	0.14
20_H	39_T	0.656	0.14
34_Q	100_E	0.656	0.14
49_V	143_F	0.653	0.14
8_P	88_S	0.649	0.13
7_G	75_I	0.641	0.13
101_C	138_L	0.641	0.13
135_D	139_T	0.635	0.13
8_P	73_T	0.632	0.13
38_L	50_R	0.626	0.13
36_L	78_T	0.625	0.13
8_P	33_Q	0.617	0.13
85_Y	88_S	0.613	0.13
10_L	37_N	0.612	0.13
128_P	142_E	0.610	0.13
8_P	22_P	0.607	0.13
99_T	144_A	0.603	0.13
72_P	118_Y	0.601	0.13
40_E	90_G	0.601	0.13
82_K	92_L	0.593	0.12
105_E	124_D	0.593	0.12
30_P	104_H	0.582	0.12
64_G	142_E	0.579	0.12
6_L	23_A	0.576	0.12
19_Y	33_Q	0.569	0.12
43_R	92_L	0.566	0.12
36_L	62_D	0.561	0.12
63_E	120_I	0.560	0.12
97_P	100_E	0.558	0.12
12_D	32_R	0.557	0.12
31_Y	139_T	0.551	0.12
60_V	121_A	0.549	0.12
19_Y	140_L	0.547	0.12
103_S	128_P	0.544	0.11
48_D	74_T	0.543	0.11
6_L	83_G	0.541	0.11
41_G	125_G	0.539	0.11
51_E	73_T	0.535	0.11
6_L	60_V	0.534	0.11
25_D	32_R	0.533	0.11
64_G	67_A	0.531	0.11
46_V	143_F	0.527	0.11
13_P	50_R	0.526	0.11
71_E	91_K	0.523	0.11
25_D	83_G	0.520	0.11
80_P	83_G	0.511	0.11
4_T	109_P	0.509	0.11
27_E	107_C	0.508	0.11
48_D	67_A	0.504	0.11
99_T	110_A	0.503	0.11
41_G	73_T	0.502	0.11
42_V	118_Y	0.502	0.11
117_E	140_L	0.501	0.11
97_P	102_P	0.500	0.11
67_A	80_P	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hikA	1	0.4324	26.3	0.948	Contact Map
1d2vC	2	0.3108	10.2	0.957	Contact Map
1c3gA	2	0.5203	8	0.959	Contact Map
2k5iA	1	0.6959	6.5	0.961	Contact Map
1giyD	1	0.5676	4.2	0.964	Contact Map
1kg2A	1	0.3311	3.9	0.965	Contact Map
2p26A	1	0.8108	3.7	0.965	Contact Map
2p28B	1	0.4662	3.5	0.966	Contact Map
2napA	1	0.3716	3.2	0.966	Contact Map
1rl2A	1	0.5811	3	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.