Q9HPZ1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPZ1 - Uncharacterized protein

UniProt:	Q9HPZ1	Sequences: MTEFAFTETVDVRYQDHDTMGHVNNAVYVTYMEQARFAYLTDGIGRAPTDLDMVVVNLSVDFNRPVEFADTVTVGASITHVGDTSFTMAYEVRDDDGVVATGETVQVALDPDTGQPRSVPDDWRRAIDAIEA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (123)
Sequences:	5631 (4131)
Seq/√Len:	372.4

ECOLI - YBGC FADM
BACSU - YSMA YNEP
HALSA - Q9HPZ1
SULSO - Q97WD2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
57_N	61_D	3.284	1.00
79_T	89_A	2.520	1.00
32_M	102_G	2.349	1.00
66_V	99_V	2.285	1.00
63_N	101_T	2.248	1.00
110_D	113_T	2.212	1.00
59_S	103_E	2.141	1.00
66_V	72_V	2.023	1.00
7_T	73_T	2.022	1.00
7_T	75_G	1.986	1.00
27_V	30_T	1.950	1.00
75_G	91_E	1.942	1.00
32_M	100_A	1.915	1.00
9_T	71_T	1.887	1.00
94_D	97_G	1.876	1.00
80_H	87_T	1.835	1.00
29_V	60_V	1.810	1.00
29_V	58_L	1.796	1.00
77_S	89_A	1.781	1.00
75_G	93_R	1.737	1.00
23_V	31_Y	1.709	1.00
93_R	98_V	1.690	1.00
121_D	125_R	1.676	1.00
9_T	73_T	1.640	1.00
91_E	98_V	1.626	1.00
61_D	101_T	1.607	1.00
60_V	100_A	1.567	1.00
52_D	111_P	1.554	1.00
70_D	94_D	1.542	1.00
87_T	103_E	1.515	1.00
74_V	92_V	1.510	1.00
90_Y	104_T	1.509	1.00
84_T	116_P	1.473	1.00
32_M	92_V	1.459	1.00
11_D	71_T	1.431	1.00
82_G	85_S	1.427	1.00
79_T	103_E	1.419	1.00
65_P	114_G	1.394	1.00
91_E	101_T	1.393	1.00
11_D	41_T	1.375	1.00
120_P	123_W	1.372	1.00
85_S	105_V	1.345	1.00
38_A	42_D	1.343	1.00
89_A	103_E	1.292	1.00
124_R	128_D	1.288	1.00
94_D	99_V	1.284	1.00
35_A	76_A	1.279	1.00
26_A	30_T	1.271	1.00
15_Q	30_T	1.262	1.00
33_E	36_R	1.257	1.00
56_V	61_D	1.220	1.00
41_T	69_A	1.195	1.00
109_L	114_G	1.184	1.00
84_T	107_V	1.177	1.00
11_D	38_A	1.170	1.00
12_V	23_V	1.151	1.00
83_D	118_S	1.143	1.00
13_R	16_D	1.134	1.00
35_A	74_V	1.127	1.00
58_L	104_T	1.115	1.00
6_F	76_A	1.113	1.00
64_R	97_G	1.092	1.00
57_N	105_V	1.080	1.00
71_T	95_D	1.076	1.00
45_G	48_P	1.067	1.00
45_G	49_T	1.052	1.00
110_D	117_R	1.048	1.00
9_T	95_D	1.027	1.00
25_N	58_L	1.023	1.00
87_T	105_V	1.007	1.00
63_N	98_V	1.006	1.00
16_D	30_T	0.999	1.00
77_S	91_E	0.993	1.00
54_V	109_L	0.986	1.00
56_V	105_V	0.960	1.00
79_T	87_T	0.958	1.00
98_V	101_T	0.946	1.00
25_N	62_F	0.937	1.00
76_A	90_Y	0.916	1.00
31_Y	72_V	0.909	1.00
73_T	95_D	0.900	1.00
10_V	74_V	0.890	1.00
57_N	103_E	0.886	1.00
122_D	125_R	0.876	1.00
125_R	128_D	0.869	1.00
72_V	99_V	0.867	1.00
51_L	108_A	0.855	1.00
6_F	42_D	0.853	1.00
89_A	101_T	0.845	1.00
78_I	88_M	0.835	1.00
8_E	38_A	0.835	1.00
121_D	124_R	0.833	1.00
50_D	112_D	0.828	1.00
84_T	118_S	0.827	1.00
12_V	31_Y	0.821	1.00
56_V	63_N	0.820	1.00
36_R	55_V	0.819	1.00
20_M	54_V	0.809	1.00
32_M	60_V	0.803	1.00
13_R	34_Q	0.788	1.00
13_R	30_T	0.781	1.00
36_R	90_Y	0.772	1.00
10_V	31_Y	0.772	1.00
121_D	128_D	0.769	1.00
25_N	29_V	0.753	1.00
8_E	35_A	0.751	1.00
30_T	33_E	0.750	1.00
58_L	102_G	0.742	1.00
14_Y	17_H	0.732	1.00
20_M	24_N	0.720	1.00
14_Y	19_T	0.712	1.00
11_D	69_A	0.705	0.99
81_V	124_R	0.704	0.99
24_N	33_E	0.702	0.99
74_V	90_Y	0.697	0.99
76_A	88_M	0.695	0.99
73_T	96_D	0.690	0.99
39_Y	78_I	0.664	0.99
38_A	41_T	0.663	0.99
16_D	31_Y	0.647	0.99
10_V	34_Q	0.642	0.99
56_V	107_V	0.642	0.99
24_N	27_V	0.627	0.99
8_E	34_Q	0.625	0.99
117_R	123_W	0.622	0.99
27_V	31_Y	0.619	0.99
81_V	127_I	0.616	0.99
73_T	93_R	0.614	0.99
36_R	106_Q	0.609	0.98
58_L	62_F	0.608	0.98
86_F	119_V	0.605	0.98
122_D	126_A	0.601	0.98
49_T	122_D	0.595	0.98
22_H	65_P	0.593	0.98
88_M	106_Q	0.592	0.98
15_Q	26_A	0.586	0.98
70_D	95_D	0.585	0.98
55_V	106_Q	0.581	0.98
56_V	85_S	0.580	0.98
111_P	114_G	0.575	0.98
16_D	27_V	0.575	0.98
14_Y	20_M	0.575	0.98
53_M	108_A	0.571	0.98
20_M	25_N	0.568	0.98
90_Y	106_Q	0.567	0.98
14_Y	68_F	0.566	0.98
34_Q	38_A	0.565	0.98
92_V	100_A	0.564	0.97
54_V	111_P	0.564	0.97
25_N	36_R	0.561	0.97
10_V	13_R	0.560	0.97
22_H	114_G	0.559	0.97
15_Q	24_N	0.559	0.97
66_V	100_A	0.559	0.97
108_A	120_P	0.558	0.97
46_R	49_T	0.554	0.97
85_S	124_R	0.551	0.97
119_V	124_R	0.545	0.97
28_Y	100_A	0.544	0.97
55_V	104_T	0.544	0.97
56_V	84_T	0.542	0.97
17_H	21_G	0.541	0.97
85_S	107_V	0.539	0.97
23_V	66_V	0.539	0.97
39_Y	76_A	0.535	0.97
15_Q	34_Q	0.534	0.97
83_D	124_R	0.531	0.96
8_E	13_R	0.529	0.96
22_H	54_V	0.526	0.96
61_D	103_E	0.525	0.96
29_V	62_F	0.524	0.96
20_M	52_D	0.519	0.96
17_H	68_F	0.516	0.96
35_A	90_Y	0.515	0.96
28_Y	66_V	0.514	0.96
124_R	127_I	0.513	0.96
36_R	104_T	0.513	0.96
70_D	99_V	0.508	0.95
81_V	86_F	0.504	0.95
60_V	102_G	0.503	0.95
82_G	124_R	0.503	0.95
80_H	105_V	0.502	0.95
118_S	121_D	0.500	0.95
36_R	88_M	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2essA	2	0.9697	100	0.287	Contact Map
2nujA	3	1	100	0.289	Contact Map
2o5uA	4	1	100	0.293	Contact Map
2ownA	3	1	100	0.294	Contact Map
2hx5A	4	0.9924	100	0.303	Contact Map
2oafA	4	1	100	0.305	Contact Map
1njkA	4	0.9697	100	0.305	Contact Map
3ck1A	4	0.9924	100	0.306	Contact Map
2w3xA	4	1	100	0.308	Contact Map
3hm0A	4	0.9015	100	0.308	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.