Q9HPX7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPX7 - Uncharacterized protein

UniProt:	Q9HPX7	Sequences: MHDLTGFQRDLLYVVAGLDEPHGLAIKDELEQYYTSEIHHGRLYPNLDTLVEKGLIDKGELDQRTNYYTLTHRGTRELEARREWETQYVGQS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	92 (87)
Sequences:	291 (131)
Seq/√Len:	14.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_R	85_E	2.840	0.96
41_G	45_P	2.733	0.95
81_R	85_E	2.581	0.94
38_I	52_E	2.411	0.91
40_H	43_L	2.387	0.91
73_R	77_E	2.306	0.89
24_L	30_L	2.063	0.83
61_L	67_Y	1.979	0.80
22_H	25_A	1.932	0.78
31_E	38_I	1.833	0.74
45_P	58_K	1.810	0.73
6_G	9_R	1.804	0.73
53_K	76_R	1.794	0.73
59_G	67_Y	1.733	0.70
5_T	74_G	1.705	0.69
73_R	76_R	1.663	0.67
15_V	28_D	1.636	0.65
35_T	48_D	1.598	0.63
5_T	42_R	1.594	0.63
6_G	10_D	1.574	0.62
45_P	74_G	1.574	0.62
21_P	67_Y	1.566	0.62
19_D	87_Q	1.533	0.60
16_A	26_I	1.477	0.57
41_G	58_K	1.436	0.55
29_E	41_G	1.394	0.53
38_I	73_R	1.364	0.51
5_T	8_Q	1.305	0.48
17_G	21_P	1.297	0.47
17_G	85_E	1.264	0.46
10_D	81_R	1.255	0.45
60_E	72_H	1.250	0.45
13_Y	81_R	1.236	0.44
22_H	30_L	1.224	0.43
15_V	70_L	1.203	0.42
58_K	84_W	1.192	0.42
15_V	21_P	1.175	0.41
4_L	8_Q	1.140	0.39
29_E	80_A	1.128	0.38
2_H	74_G	1.101	0.37
22_H	61_L	1.073	0.36
53_K	88_Y	1.067	0.35
39_H	63_Q	1.046	0.34
45_P	48_D	1.035	0.34
33_Y	84_W	1.013	0.33
56_I	75_T	0.990	0.32
29_E	33_Y	0.968	0.31
8_Q	27_K	0.965	0.30
3_D	87_Q	0.925	0.29
54_G	73_R	0.921	0.28
81_R	84_W	0.916	0.28
77_E	80_A	0.902	0.28
82_R	86_T	0.899	0.28
34_Y	38_I	0.899	0.28
29_E	55_L	0.867	0.26
74_G	79_E	0.860	0.26
33_Y	71_T	0.852	0.26
45_P	49_T	0.850	0.25
15_V	56_I	0.849	0.25
9_R	49_T	0.840	0.25
56_I	79_E	0.821	0.24
7_F	64_R	0.816	0.24
38_I	59_G	0.800	0.23
3_D	34_Y	0.797	0.23
49_T	53_K	0.790	0.23
6_G	21_P	0.789	0.23
2_H	35_T	0.778	0.23
39_H	62_D	0.765	0.22
24_L	34_Y	0.763	0.22
13_Y	85_E	0.760	0.22
43_L	62_D	0.760	0.22
11_L	37_E	0.749	0.21
52_E	72_H	0.744	0.21
23_G	66_N	0.728	0.21
80_A	85_E	0.722	0.21
19_D	26_I	0.720	0.20
78_L	86_T	0.719	0.20
3_D	40_H	0.719	0.20
58_K	66_N	0.711	0.20
40_H	62_D	0.709	0.20
58_K	81_R	0.701	0.20
41_G	65_T	0.690	0.19
9_R	12_L	0.688	0.19
4_L	31_E	0.679	0.19
9_R	21_P	0.669	0.19
68_Y	71_T	0.668	0.19
35_T	39_H	0.658	0.18
5_T	46_N	0.657	0.18
48_D	83_E	0.655	0.18
55_L	77_E	0.654	0.18
51_V	65_T	0.650	0.18
20_E	70_L	0.650	0.18
29_E	53_K	0.640	0.18
54_G	80_A	0.640	0.18
41_G	66_N	0.636	0.18
11_L	49_T	0.632	0.18
42_R	55_L	0.627	0.17
20_E	24_L	0.626	0.17
13_Y	17_G	0.626	0.17
13_Y	84_W	0.624	0.17
61_L	75_T	0.619	0.17
74_G	83_E	0.607	0.17
3_D	76_R	0.603	0.17
16_A	72_H	0.601	0.17
20_E	30_L	0.600	0.17
37_E	73_R	0.598	0.16
32_Q	35_T	0.594	0.16
10_D	17_G	0.588	0.16
14_V	71_T	0.587	0.16
40_H	55_L	0.587	0.16
47_L	65_T	0.582	0.16
20_E	69_T	0.581	0.16
31_E	49_T	0.581	0.16
51_V	56_I	0.580	0.16
45_P	63_Q	0.574	0.16
54_G	70_L	0.572	0.16
41_G	51_V	0.571	0.16
35_T	78_L	0.561	0.15
21_P	78_L	0.550	0.15
9_R	15_V	0.545	0.15
45_P	60_E	0.543	0.15
11_L	46_N	0.543	0.15
10_D	13_Y	0.541	0.15
29_E	88_Y	0.534	0.15
23_G	64_R	0.529	0.15
28_D	79_E	0.528	0.14
48_D	74_G	0.523	0.14
51_V	81_R	0.513	0.14
3_D	56_I	0.507	0.14
20_E	56_I	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2co5A	2	0.9783	98.7	0.746	Contact Map
3l9fA	2	0.9022	98.6	0.759	Contact Map
1yg2A	2	0.8478	98.4	0.774	Contact Map
3f8bA	2	0.9674	98.4	0.776	Contact Map
1xmaA	2	0.9565	98.3	0.777	Contact Map
3elkA	3	0.9674	98.3	0.779	Contact Map
2e1nA	2	0.9457	98.3	0.78	Contact Map
2zfwA	2	0.9783	98.3	0.78	Contact Map
2eshA	2	0.9783	98.3	0.781	Contact Map
2dqlA	2	0.9783	98.2	0.782	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.