Q9HPX3 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPX3 - Uncharacterized protein

UniProt:	Q9HPX3	Sequences: MSAGEHAGGVFLGGIAIDEPTREAARAMVDRDREEFLPADPVAWVDDQLSELDDAFLRPAVNVRAVRLGPLRDVAAVCAAHDAILEVNAHCRQDELCDAGAGETLLRDTSRLCEQVRAASDEGAAVSVKVRAGVQGVHLPVLAQAIERAGAAAIHVDAMDSRRVVRDVADATALFVVANNGVRTRDDVFEYLSYGADAVSVGRPSRDPERVRAVYAAVKEWLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	223 (194)
Sequences:	6953 (4100)
Seq/√Len:	294.4

ECOLI - DUSA DUSB DUSC
BACSU - DUS1 DUS2
HALSA - Q9HPX3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
169_A	197_D	3.951	1.00
184_T	187_D	2.994	1.00
120_S	152_A	2.852	1.00
79_A	123_G	2.808	1.00
183_R	187_D	2.539	1.00
147_E	173_A	2.386	1.00
207_D	213_A	2.380	1.00
89_A	112_L	2.192	1.00
113_C	149_A	2.182	1.00
178_A	191_Y	2.160	1.00
57_L	83_A	2.158	1.00
166_R	170_D	2.134	1.00
116_V	151_A	2.103	1.00
117_R	121_D	2.101	1.00
189_F	193_S	2.001	1.00
107_R	134_V	1.978	1.00
147_E	174_L	1.925	1.00
182_V	191_Y	1.921	1.00
132_A	164_V	1.909	1.00
60_A	84_I	1.847	1.00
113_C	117_R	1.804	1.00
188_V	199_V	1.787	1.00
113_C	148_R	1.740	1.00
167_D	170_D	1.733	1.00
113_C	145_A	1.729	1.00
73_D	76_A	1.728	1.00
108_D	111_R	1.700	1.00
189_F	217_A	1.689	1.00
183_R	204_P	1.674	1.00
71_L	87_V	1.668	1.00
122_E	126_V	1.647	1.00
79_A	122_E	1.647	1.00
75_A	122_E	1.646	1.00
100_G	108_D	1.619	1.00
61_V	78_C	1.617	1.00
144_Q	171_A	1.586	1.00
112_L	142_L	1.583	1.00
187_D	190_E	1.560	1.00
71_L	119_A	1.541	1.00
69_G	73_D	1.540	1.00
43_A	46_D	1.534	1.00
67_R	70_P	1.523	1.00
31_R	60_A	1.494	1.00
65_A	71_L	1.474	1.00
177_V	198_A	1.470	1.00
30_D	215_Y	1.463	1.00
144_Q	147_E	1.454	1.00
140_P	171_A	1.448	1.00
165_V	178_A	1.442	1.00
48_Q	51_E	1.429	1.00
79_A	124_A	1.427	1.00
68_L	72_R	1.417	1.00
147_E	172_T	1.414	1.00
141_V	144_Q	1.413	1.00
190_E	193_S	1.410	1.00
114_E	117_R	1.407	1.00
117_R	149_A	1.370	1.00
139_L	168_V	1.354	1.00
111_R	114_E	1.353	1.00
177_V	200_S	1.351	1.00
130_V	156_V	1.335	1.00
128_V	146_I	1.334	1.00
169_A	176_V	1.325	1.00
87_V	119_A	1.319	1.00
188_V	214_V	1.300	1.00
110_S	114_E	1.299	1.00
186_D	190_E	1.299	1.00
40_D	70_P	1.276	1.00
153_A	177_V	1.267	1.00
144_Q	148_R	1.266	1.00
110_S	145_A	1.257	1.00
178_A	182_V	1.254	1.00
157_D	161_S	1.245	1.00
164_V	167_D	1.239	1.00
45_V	48_Q	1.212	1.00
46_D	49_L	1.202	1.00
103_E	161_S	1.195	1.00
44_W	48_Q	1.182	1.00
120_S	126_V	1.172	1.00
201_V	214_V	1.163	1.00
112_L	146_I	1.160	1.00
128_V	151_A	1.144	1.00
78_C	85_L	1.134	1.00
127_S	153_A	1.127	1.00
143_A	168_V	1.109	1.00
185_R	189_F	1.103	1.00
166_R	191_Y	1.103	1.00
141_V	145_A	1.095	1.00
116_V	128_V	1.093	1.00
172_T	176_V	1.091	1.00
106_L	142_L	1.087	1.00
33_R	155_H	1.071	1.00
157_D	162_R	1.066	1.00
72_R	118_A	1.046	1.00
72_R	76_A	1.045	1.00
159_M	162_R	1.033	1.00
178_A	196_A	1.023	1.00
44_W	47_D	1.021	1.00
73_D	77_V	1.017	1.00
185_R	217_A	1.006	1.00
33_R	60_A	1.005	1.00
132_A	137_V	0.982	1.00
116_V	146_I	0.980	1.00
42_V	77_V	0.978	1.00
118_A	121_D	0.978	1.00
205_S	211_V	0.978	1.00
145_A	149_A	0.976	1.00
158_A	161_S	0.973	1.00
109_T	141_V	0.969	1.00
106_L	130_V	0.964	1.00
132_A	158_A	0.959	1.00
185_R	213_A	0.953	1.00
68_L	114_E	0.953	1.00
45_V	49_L	0.950	1.00
93_Q	96_L	0.946	1.00
31_R	84_I	0.939	1.00
71_L	115_Q	0.937	1.00
142_L	146_I	0.925	1.00
158_A	165_V	0.924	1.00
110_S	113_C	0.921	1.00
46_D	50_S	0.907	1.00
167_D	171_A	0.904	1.00
191_Y	194_Y	0.904	1.00
181_G	203_R	0.902	1.00
75_A	85_L	0.902	1.00
75_A	119_A	0.891	1.00
47_D	51_E	0.889	1.00
140_P	167_D	0.888	1.00
136_G	167_D	0.885	1.00
69_G	118_A	0.883	1.00
191_Y	196_A	0.883	1.00
157_D	160_D	0.875	1.00
205_S	210_R	0.871	1.00
139_L	164_V	0.870	1.00
143_A	172_T	0.869	1.00
105_L	115_Q	0.869	1.00
43_A	49_L	0.866	1.00
116_V	149_A	0.864	1.00
106_L	138_H	0.857	1.00
68_L	111_R	0.854	1.00
76_A	79_A	0.848	1.00
136_G	164_V	0.843	1.00
63_V	74_V	0.838	1.00
182_V	188_V	0.836	1.00
89_A	128_V	0.823	1.00
138_H	141_V	0.820	1.00
49_L	52_L	0.818	1.00
156_V	176_V	0.817	1.00
130_V	139_L	0.816	1.00
44_W	50_S	0.812	1.00
100_G	104_T	0.810	1.00
46_D	51_E	0.805	1.00
48_Q	52_L	0.804	1.00
97_C	104_T	0.804	1.00
155_H	200_S	0.801	1.00
38_P	41_P	0.794	0.99
112_L	116_V	0.794	0.99
39_A	74_V	0.784	0.99
29_V	32_D	0.784	0.99
182_V	199_V	0.780	0.99
76_A	80_A	0.779	0.99
179_N	200_S	0.779	0.99
136_G	171_A	0.777	0.99
117_R	148_R	0.765	0.99
204_P	207_D	0.762	0.99
78_C	82_D	0.759	0.99
60_A	127_S	0.755	0.99
146_I	151_A	0.751	0.99
135_Q	162_R	0.749	0.99
84_I	127_S	0.748	0.99
163_R	167_D	0.746	0.99
130_V	142_L	0.744	0.99
120_S	149_A	0.742	0.99
77_V	81_H	0.742	0.99
47_D	50_S	0.732	0.99
166_R	194_Y	0.727	0.99
90_H	179_N	0.726	0.99
43_A	47_D	0.725	0.99
26_R	55_A	0.724	0.99
44_W	52_L	0.721	0.99
104_T	107_R	0.717	0.99
153_A	175_F	0.715	0.99
140_P	168_V	0.715	0.99
140_P	144_Q	0.715	0.99
45_V	51_E	0.713	0.99
213_A	217_A	0.712	0.99
25_A	56_F	0.711	0.99
185_R	214_V	0.711	0.99
45_V	50_S	0.711	0.99
151_A	154_I	0.711	0.99
154_I	174_L	0.709	0.99
86_E	155_H	0.702	0.99
156_V	168_V	0.700	0.99
38_P	64_R	0.699	0.99
44_W	49_L	0.699	0.99
135_Q	160_D	0.698	0.99
192_L	199_V	0.693	0.99
27_A	212_R	0.692	0.99
212_R	216_A	0.691	0.99
66_V	100_G	0.691	0.99
72_R	122_E	0.688	0.98
185_R	188_V	0.684	0.98
142_L	145_A	0.683	0.98
77_V	80_A	0.680	0.98
34_E	59_P	0.674	0.98
130_V	143_A	0.674	0.98
72_R	121_D	0.673	0.98
209_E	212_R	0.671	0.98
52_L	59_P	0.667	0.98
165_V	176_V	0.667	0.98
100_G	111_R	0.666	0.98
158_A	162_R	0.665	0.98
29_V	205_S	0.662	0.98
70_P	73_D	0.661	0.98
106_L	133_G	0.659	0.98
96_L	101_A	0.659	0.98
45_V	52_L	0.653	0.98
68_L	118_A	0.653	0.98
68_L	115_Q	0.652	0.98
39_A	70_P	0.651	0.98
63_V	71_L	0.642	0.98
156_V	159_M	0.640	0.98
61_V	82_D	0.638	0.98
89_A	146_I	0.636	0.97
187_D	191_Y	0.636	0.97
125_A	152_A	0.635	0.97
189_F	192_L	0.634	0.97
143_A	154_I	0.632	0.97
109_T	145_A	0.628	0.97
44_W	51_E	0.622	0.97
114_E	118_A	0.619	0.97
186_D	189_F	0.616	0.97
36_F	64_R	0.614	0.97
47_D	52_L	0.610	0.97
80_A	123_G	0.610	0.97
188_V	192_L	0.609	0.97
42_V	46_D	0.606	0.97
94_D	98_D	0.606	0.97
119_A	126_V	0.603	0.97
120_S	151_A	0.602	0.97
34_E	61_V	0.601	0.96
168_V	171_A	0.600	0.96
108_D	114_E	0.598	0.96
145_A	148_R	0.598	0.96
130_V	154_I	0.597	0.96
186_D	217_A	0.594	0.96
94_D	97_C	0.592	0.96
40_D	67_R	0.591	0.96
201_V	210_R	0.591	0.96
43_A	50_S	0.589	0.96
109_T	113_C	0.588	0.96
53_D	56_F	0.582	0.96
51_E	81_H	0.577	0.96
140_P	143_A	0.575	0.95
107_R	138_H	0.575	0.95
43_A	48_Q	0.570	0.95
192_L	196_A	0.568	0.95
207_D	210_R	0.566	0.95
66_V	101_A	0.562	0.95
140_P	164_V	0.562	0.95
201_V	205_S	0.558	0.95
107_R	135_Q	0.557	0.95
85_L	122_E	0.555	0.95
97_C	134_V	0.551	0.94
92_R	161_S	0.547	0.94
51_E	54_D	0.546	0.94
140_P	172_T	0.543	0.94
156_V	161_S	0.539	0.94
136_G	140_P	0.539	0.94
155_H	177_V	0.534	0.93
58_R	83_A	0.532	0.93
36_F	39_A	0.532	0.93
113_C	146_I	0.531	0.93
106_L	112_L	0.525	0.93
190_E	194_Y	0.523	0.93
183_R	202_G	0.522	0.93
86_E	127_S	0.522	0.93
170_D	195_G	0.521	0.93
204_P	210_R	0.519	0.92
163_R	166_R	0.516	0.92
90_H	200_S	0.516	0.92
87_V	116_V	0.515	0.92
105_L	111_R	0.515	0.92
46_D	52_L	0.514	0.92
138_H	142_L	0.510	0.92
115_Q	118_A	0.509	0.92
47_D	81_H	0.507	0.91
169_A	195_G	0.505	0.91
60_A	153_A	0.504	0.91
182_V	201_V	0.502	0.91
135_Q	138_H	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3b0pA	1	0.9865	100	0.401	Contact Map
4xp7A	1	0.9596	100	0.413	Contact Map
4bfaA	1	0.991	100	0.423	Contact Map
1vhnA	1	0.9686	100	0.43	Contact Map
1gteA	4	0.9865	100	0.539	Contact Map
4ef8A	2	0.9776	100	0.571	Contact Map
1o94A	2	0.9955	100	0.575	Contact Map
3k30A	2	0.9955	100	0.581	Contact Map
1ps9A	1	1	100	0.583	Contact Map
3tjlA	2	1	100	0.589	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.