Q9HPW2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPW2 - Uncharacterized protein

UniProt:	Q9HPW2	Sequences: MLTVEGEDSQPLYVATDEGETGQDGPFFVVYRTPDRERRWGWYCSNCESIDNAMDSMGRIECNGCGNFRKPEEWDAAHE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	79 (73)
Sequences:	112 (75)
Seq/√Len:	8.8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
73_E	78_H	3.479	0.95
15_A	18_E	3.290	0.94
28_F	45_S	3.024	0.90
54_M	58_G	2.521	0.80
40_W	78_H	2.197	0.69
30_V	77_A	2.157	0.68
40_W	72_E	2.147	0.67
53_A	63_N	1.885	0.57
16_T	73_E	1.755	0.51
16_T	40_W	1.651	0.47
53_A	60_I	1.602	0.45
26_P	45_S	1.553	0.43
71_P	77_A	1.541	0.42
54_M	69_R	1.528	0.41
21_T	45_S	1.464	0.39
18_E	26_P	1.432	0.38
14_V	56_S	1.396	0.36
12_L	69_R	1.393	0.36
39_R	77_A	1.357	0.35
25_G	72_E	1.356	0.35
25_G	78_H	1.343	0.34
55_D	71_P	1.276	0.31
40_W	73_E	1.240	0.30
52_N	58_G	1.235	0.30
47_C	58_G	1.224	0.30
61_E	66_G	1.176	0.28
33_T	64_G	1.157	0.27
6_G	12_L	1.156	0.27
11_P	29_V	1.136	0.27
16_T	42_W	1.115	0.26
11_P	60_I	1.110	0.26
16_T	28_F	1.073	0.24
70_K	76_A	1.066	0.24
42_W	60_I	1.060	0.24
49_S	52_N	1.058	0.24
55_D	59_R	1.057	0.24
34_P	37_E	1.043	0.24
8_D	13_Y	1.040	0.23
17_D	45_S	1.034	0.23
24_D	63_N	1.014	0.23
24_D	71_P	1.012	0.23
58_G	72_E	0.999	0.22
18_E	49_S	0.997	0.22
70_K	74_W	0.994	0.22
51_D	56_S	0.965	0.21
41_G	69_R	0.904	0.20
15_A	42_W	0.901	0.19
52_N	63_N	0.890	0.19
11_P	39_R	0.889	0.19
56_S	76_A	0.876	0.19
14_V	31_Y	0.866	0.19
21_T	73_E	0.853	0.18
20_E	47_C	0.847	0.18
23_Q	74_W	0.823	0.17
21_T	57_M	0.807	0.17
50_I	54_M	0.806	0.17
12_L	64_G	0.799	0.17
23_Q	72_E	0.796	0.17
28_F	61_E	0.787	0.17
35_D	50_I	0.784	0.16
15_A	33_T	0.782	0.16
25_G	68_F	0.774	0.16
15_A	71_P	0.773	0.16
26_P	49_S	0.768	0.16
68_F	73_E	0.758	0.16
25_G	29_V	0.756	0.16
10_Q	13_Y	0.734	0.15
50_I	76_A	0.719	0.15
6_G	51_D	0.713	0.15
42_W	54_M	0.711	0.15
21_T	76_A	0.705	0.15
40_W	66_G	0.700	0.15
20_E	28_F	0.694	0.14
21_T	26_P	0.691	0.14
9_S	77_A	0.688	0.14
48_E	76_A	0.679	0.14
13_Y	50_I	0.671	0.14
6_G	20_E	0.669	0.14
8_D	30_V	0.668	0.14
34_P	64_G	0.652	0.14
52_N	60_I	0.637	0.13
32_R	64_G	0.629	0.13
18_E	46_N	0.627	0.13
33_T	37_E	0.610	0.13
38_R	78_H	0.608	0.13
51_D	63_N	0.606	0.13
32_R	42_W	0.601	0.13
15_A	41_G	0.584	0.12
54_M	63_N	0.582	0.12
54_M	59_R	0.573	0.12
21_T	74_W	0.572	0.12
28_F	68_F	0.570	0.12
20_E	64_G	0.570	0.12
21_T	56_S	0.566	0.12
47_C	72_E	0.555	0.12
41_G	50_I	0.554	0.12
35_D	48_E	0.545	0.12
38_R	68_F	0.540	0.12
74_W	77_A	0.539	0.11
12_L	50_I	0.535	0.11
7_E	60_I	0.528	0.11
30_V	70_K	0.527	0.11
68_F	72_E	0.525	0.11
16_T	78_H	0.521	0.11
36_R	64_G	0.520	0.11
14_V	30_V	0.516	0.11
34_P	42_W	0.512	0.11
50_I	61_E	0.506	0.11
12_L	71_P	0.500	0.11
24_D	51_D	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4l2nA	2	0.9367	64.2	0.901	Contact Map
1zvfA	2	0.9114	51.2	0.909	Contact Map
1vq8Z	1	0.7595	44.5	0.913	Contact Map
4bbrM	1	0.481	43.7	0.913	Contact Map
1nuiA	1	0.519	30.6	0.92	Contact Map
1twfL	1	0.4937	28.3	0.921	Contact Map
2k4xA	1	0.6203	27.2	0.922	Contact Map
4k95A	4	0.519	25	0.923	Contact Map
5c1zA	2	0.8481	24.8	0.924	Contact Map
2vutI	1	0.481	23.5	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.