Q9HPU9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPU9 - Bacterio-opsin linked product

UniProt:	Q9HPU9	Sequences: MFTVEQQATIDAPPGDVFSFLDDPRNHVKITPGLITVTDVEALASGGKRAKYRYKLAGVELVGTVEDIERVPERRLVQELTGAIDGTITYRLSGDDTTSLTYEAEYDLPDTVIESVLAPIAKAYNKREAAATVDNLTTFLEH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	142 (137)
Sequences:	429 (359)
Seq/√Len:	30.7

HALSA - Q9HPU9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_V	74_R	5.200	1.00
12_A	16_D	4.930	1.00
20_F	29_K	3.942	1.00
14_P	94_G	3.871	1.00
93_S	99_S	3.143	1.00
8_A	137_T	3.042	1.00
20_F	26_N	3.004	1.00
137_T	141_E	2.943	1.00
14_P	74_R	2.645	1.00
21_L	92_L	2.637	1.00
49_R	66_E	2.574	1.00
15_G	73_E	2.523	0.99
14_P	92_L	2.468	0.99
94_G	97_T	2.202	0.99
66_E	79_E	2.078	0.98
10_I	17_V	1.940	0.97
92_L	98_T	1.790	0.95
106_Y	109_P	1.771	0.94
36_T	53_R	1.730	0.94
38_T	51_K	1.694	0.93
7_Q	100_L	1.609	0.91
22_D	70_R	1.576	0.90
53_R	60_E	1.572	0.90
9_T	99_S	1.536	0.89
6_Q	130_A	1.475	0.87
114_E	119_P	1.464	0.86
83_A	90_Y	1.454	0.86
74_R	94_G	1.437	0.85
20_F	140_L	1.429	0.85
36_T	114_E	1.425	0.85
19_S	72_P	1.358	0.82
30_I	136_L	1.356	0.82
107_D	138_T	1.342	0.81
40_V	49_R	1.319	0.80
54_Y	106_Y	1.310	0.79
52_Y	63_G	1.304	0.79
9_T	97_T	1.285	0.78
21_L	136_L	1.276	0.78
33_G	128_E	1.252	0.76
41_E	67_D	1.249	0.76
42_A	46_G	1.209	0.74
26_N	29_K	1.150	0.70
12_A	20_F	1.145	0.69
18_F	70_R	1.145	0.69
12_A	140_L	1.144	0.69
51_K	62_V	1.126	0.68
37_V	59_V	1.117	0.68
82_G	113_I	1.103	0.67
74_R	96_D	1.093	0.66
31_T	54_Y	1.076	0.65
22_D	67_D	1.073	0.64
27_H	34_L	1.039	0.62
108_L	121_A	1.033	0.61
14_P	97_T	1.014	0.60
68_I	75_R	1.012	0.60
34_L	54_Y	1.000	0.59
15_G	19_S	0.993	0.58
107_D	123_A	0.989	0.58
10_I	137_T	0.989	0.58
26_N	68_I	0.987	0.58
11_D	141_E	0.977	0.57
86_G	106_Y	0.962	0.56
36_T	116_V	0.956	0.55
6_Q	129_A	0.949	0.55
30_I	67_D	0.946	0.55
69_E	115_S	0.940	0.54
134_D	138_T	0.940	0.54
36_T	68_I	0.931	0.53
53_R	62_V	0.930	0.53
103_E	116_V	0.924	0.53
54_Y	63_G	0.922	0.53
35_I	55_K	0.918	0.52
56_L	125_N	0.910	0.52
19_S	38_T	0.906	0.51
68_I	77_V	0.899	0.51
7_Q	91_R	0.896	0.51
8_A	20_F	0.891	0.50
12_A	17_V	0.887	0.50
13_P	98_T	0.873	0.49
87_T	105_E	0.871	0.49
68_I	95_D	0.870	0.48
72_P	93_S	0.866	0.48
92_L	100_L	0.864	0.48
6_Q	126_K	0.857	0.47
21_L	133_V	0.855	0.47
40_V	126_K	0.850	0.47
55_K	60_E	0.843	0.46
32_P	135_N	0.843	0.46
63_G	104_A	0.838	0.46
53_R	71_V	0.829	0.45
37_V	50_A	0.820	0.44
10_I	141_E	0.818	0.44
52_Y	102_Y	0.810	0.44
9_T	94_G	0.809	0.44
80_L	101_T	0.808	0.44
45_S	67_D	0.800	0.43
3_T	105_E	0.797	0.43
20_F	139_F	0.795	0.42
125_N	128_E	0.786	0.42
119_P	126_K	0.785	0.42
55_K	93_S	0.782	0.41
28_V	76_L	0.779	0.41
32_P	129_A	0.769	0.40
38_T	59_V	0.768	0.40
19_S	115_S	0.767	0.40
96_D	103_E	0.757	0.40
30_I	78_Q	0.753	0.39
36_T	42_A	0.745	0.39
90_Y	106_Y	0.743	0.38
50_A	117_L	0.742	0.38
38_T	134_D	0.741	0.38
22_D	73_E	0.740	0.38
14_P	64_T	0.739	0.38
31_T	56_L	0.732	0.38
68_I	79_E	0.731	0.38
27_H	84_I	0.729	0.37
29_K	139_F	0.726	0.37
51_K	120_I	0.724	0.37
70_R	82_G	0.720	0.37
20_F	47_G	0.720	0.37
44_A	48_K	0.719	0.37
42_A	50_A	0.717	0.37
41_E	99_S	0.707	0.36
86_G	104_A	0.703	0.35
96_D	134_D	0.700	0.35
7_Q	66_E	0.698	0.35
120_I	123_A	0.689	0.34
73_E	92_L	0.689	0.34
43_L	48_K	0.678	0.34
106_Y	132_T	0.672	0.33
119_P	129_A	0.669	0.33
19_S	134_D	0.667	0.33
30_I	65_V	0.664	0.33
5_E	91_R	0.660	0.32
86_G	113_I	0.654	0.32
50_A	67_D	0.652	0.32
52_Y	104_A	0.651	0.32
44_A	70_R	0.642	0.31
31_T	102_Y	0.635	0.31
130_A	137_T	0.634	0.31
75_R	96_D	0.627	0.30
52_Y	65_V	0.622	0.30
5_E	138_T	0.622	0.30
65_V	128_E	0.622	0.30
57_A	113_I	0.621	0.30
69_E	77_V	0.618	0.29
51_K	64_T	0.618	0.29
46_G	59_V	0.612	0.29
123_A	133_V	0.609	0.29
38_T	53_R	0.609	0.29
57_A	86_G	0.606	0.29
22_D	39_D	0.606	0.29
117_L	127_R	0.598	0.28
56_L	59_V	0.598	0.28
18_F	25_R	0.588	0.28
120_I	138_T	0.587	0.27
134_D	140_L	0.586	0.27
11_D	55_K	0.584	0.27
63_G	90_Y	0.584	0.27
25_R	123_A	0.583	0.27
59_V	84_I	0.580	0.27
61_L	89_T	0.580	0.27
31_T	52_Y	0.576	0.27
7_Q	71_V	0.574	0.27
29_K	60_E	0.574	0.27
27_H	125_N	0.574	0.27
42_A	45_S	0.574	0.27
82_G	139_F	0.572	0.27
11_D	45_S	0.571	0.26
5_E	130_A	0.568	0.26
39_D	48_K	0.567	0.26
73_E	95_D	0.565	0.26
18_F	73_E	0.564	0.26
30_I	54_Y	0.564	0.26
35_I	140_L	0.564	0.26
91_R	96_D	0.563	0.26
41_E	94_G	0.558	0.26
34_L	52_Y	0.557	0.26
53_R	107_D	0.550	0.25
40_V	98_T	0.549	0.25
64_T	103_E	0.549	0.25
55_K	122_K	0.548	0.25
11_D	73_E	0.541	0.25
119_P	140_L	0.541	0.25
6_Q	10_I	0.537	0.24
93_S	105_E	0.536	0.24
74_R	93_S	0.534	0.24
110_D	114_E	0.533	0.24
29_K	123_A	0.532	0.24
61_L	79_E	0.528	0.24
16_D	49_R	0.528	0.24
13_P	92_L	0.524	0.24
11_D	140_L	0.524	0.24
13_P	58_G	0.521	0.23
38_T	95_D	0.521	0.23
88_I	100_L	0.518	0.23
30_I	83_A	0.515	0.23
82_G	133_V	0.514	0.23
67_D	90_Y	0.511	0.23
20_F	115_S	0.510	0.23
8_A	16_D	0.508	0.23
31_T	128_E	0.506	0.23
31_T	65_V	0.505	0.23
91_R	103_E	0.501	0.22
32_P	133_V	0.500	0.22
63_G	106_Y	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2d4rA	4	0.9859	99.9	0.413	Contact Map
3tfzA	2	0.993	99.9	0.452	Contact Map
3ggnA	2	0.8662	99.9	0.455	Contact Map
1t17A	1	0.9718	99.9	0.456	Contact Map
3tl1A	1	0.9789	99.9	0.47	Contact Map
2m47A	1	0.9789	99.9	0.481	Contact Map
2ns9A	2	0.9648	99.8	0.491	Contact Map
2pcsA	1	0.9648	99.8	0.491	Contact Map
3ijtA	2	0.9507	99.8	0.502	Contact Map
2le1A	1	0.9437	99.8	0.503	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.