Q9HPT3 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPT3 - Serine acetyltransferase

UniProt:	Q9HPT3	Sequences: MYARIREDVRAMRRRDPAAGSRLDVALTYPGLHAVWAHVFLAGPLYDRWPTAGRLVAYWVRLLTGIEIHPDADIGRRVTIDHGHGVVIGETAVVGDDVHMYHGVTLGGNDSRPVDRHPTVRAGVTLGANATLLGDIEIGANASVGAASVVTDDVAAGATVTGVPAQRVDDA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (143)
Sequences:	6730 (4211)
Seq/√Len:	352.1

ECOLI - CYSE WCAB WCAF THGA MAA WBBJ YRDA CAIE PAAY YAIX
BACSU - CYSE MAA YVOF DAPH EPSM YTOA
HALSA - Q9HPT3 Q9HQ06 Q9HNN1
SULSO - Q980E1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
121_R	140_A	3.334	1.00
141_N	157_G	3.208	1.00
77_R	97_D	3.015	1.00
76_R	96_D	2.894	1.00
123_G	141_N	2.891	1.00
86_V	92_A	2.730	1.00
140_A	156_A	2.515	1.00
73_D	93_V	2.476	1.00
106_L	118_P	2.430	1.00
122_A	140_A	2.421	1.00
154_V	160_V	2.309	1.00
97_D	123_G	2.180	1.00
160_V	165_A	2.107	1.00
145_G	161_T	2.086	1.00
133_L	146_A	2.029	1.00
161_T	168_V	2.009	1.00
142_A	158_A	2.005	1.00
95_G	122_A	1.963	1.00
120_V	126_L	1.927	1.00
121_R	137_E	1.867	1.00
75_G	96_D	1.843	1.00
142_A	156_A	1.790	1.00
96_D	122_A	1.728	1.00
93_V	119_T	1.704	1.00
83_G	103_G	1.696	1.00
106_L	120_V	1.583	1.00
136_I	153_D	1.582	1.00
107_G	128_A	1.565	1.00
142_A	154_V	1.562	1.00
49_W	53_G	1.488	1.00
131_T	147_A	1.485	1.00
74_I	78_V	1.484	1.00
119_T	137_E	1.484	1.00
148_S	165_A	1.429	1.00
158_A	167_R	1.428	1.00
155_A	167_R	1.403	1.00
160_V	167_R	1.401	1.00
137_E	153_D	1.399	1.00
98_V	122_A	1.384	1.00
78_V	122_A	1.367	1.00
126_L	130_A	1.343	1.00
42_A	46_Y	1.336	1.00
126_L	132_L	1.324	1.00
44_P	48_R	1.321	1.00
95_G	121_R	1.270	1.00
41_L	46_Y	1.261	1.00
105_T	129_N	1.233	1.00
100_M	106_L	1.227	1.00
43_G	46_Y	1.197	1.00
155_A	158_A	1.187	1.00
121_R	156_A	1.180	1.00
89_G	115_D	1.176	1.00
103_G	129_N	1.175	1.00
143_S	159_T	1.154	1.00
73_D	91_T	1.140	1.00
32_L	36_W	1.128	1.00
100_M	126_L	1.114	1.00
85_G	103_G	1.095	1.00
139_G	156_A	1.081	1.00
78_V	96_D	1.078	1.00
94_V	120_V	1.060	1.00
78_V	98_V	1.057	1.00
100_M	104_V	1.054	1.00
58_Y	73_D	1.048	1.00
42_A	45_L	1.030	1.00
42_A	48_R	1.028	1.00
94_V	100_M	1.025	1.00
34_A	38_H	1.013	1.00
80_I	100_M	1.008	1.00
98_V	120_V	0.999	1.00
138_I	144_V	0.994	1.00
74_I	94_V	0.983	1.00
35_V	39_V	0.980	1.00
144_V	154_V	0.979	1.00
124_V	142_A	0.977	1.00
98_V	140_A	0.962	1.00
105_T	128_A	0.948	1.00
140_A	157_G	0.946	1.00
149_V	163_V	0.939	1.00
50_P	53_G	0.930	1.00
66_I	83_G	0.927	1.00
97_D	122_A	0.927	1.00
123_G	140_A	0.917	1.00
155_A	160_V	0.916	1.00
90_E	115_D	0.914	1.00
44_P	47_D	0.910	1.00
131_T	149_V	0.910	1.00
41_L	45_L	0.908	1.00
138_I	142_A	0.906	1.00
102_H	128_A	0.902	1.00
39_V	43_G	0.897	1.00
43_G	47_D	0.888	1.00
129_N	147_A	0.886	1.00
74_I	80_I	0.874	1.00
104_V	130_A	0.871	1.00
120_V	124_V	0.867	1.00
80_I	84_H	0.861	1.00
43_G	48_R	0.853	1.00
118_P	134_G	0.846	1.00
98_V	124_V	0.839	1.00
110_D	114_V	0.823	1.00
130_A	148_S	0.823	1.00
158_A	161_T	0.818	1.00
37_A	60_V	0.818	1.00
161_T	165_A	0.812	1.00
27_L	51_T	0.811	1.00
147_A	163_V	0.809	1.00
101_Y	125_T	0.806	1.00
38_H	42_A	0.806	1.00
59_W	63_L	0.797	1.00
35_V	38_H	0.796	1.00
94_V	106_L	0.793	1.00
132_L	136_I	0.792	1.00
41_L	44_P	0.784	1.00
110_D	116_R	0.781	1.00
33_H	37_A	0.779	1.00
80_I	86_V	0.761	1.00
51_T	55_L	0.760	1.00
94_V	98_V	0.758	1.00
79_T	99_H	0.749	1.00
124_V	156_A	0.743	1.00
144_V	160_V	0.742	1.00
115_D	119_T	0.739	1.00
78_V	94_V	0.737	1.00
103_G	131_T	0.736	1.00
39_V	46_Y	0.733	1.00
105_T	131_T	0.729	0.99
31_G	35_V	0.728	0.99
61_R	79_T	0.722	0.99
121_R	142_A	0.722	0.99
131_T	163_V	0.718	0.99
66_I	72_A	0.712	0.99
78_V	100_M	0.712	0.99
110_D	134_G	0.710	0.99
65_G	82_H	0.704	0.99
124_V	140_A	0.701	0.99
133_L	151_T	0.698	0.99
138_I	154_V	0.683	0.99
120_V	138_I	0.678	0.99
88_I	92_A	0.677	0.99
39_V	42_A	0.677	0.99
45_L	48_R	0.676	0.99
29_Y	32_L	0.668	0.99
30_P	70_P	0.667	0.99
52_A	56_V	0.662	0.99
71_D	90_E	0.661	0.99
139_G	155_A	0.659	0.99
161_T	166_Q	0.647	0.99
159_T	169_D	0.644	0.99
125_T	143_S	0.643	0.99
93_V	135_D	0.643	0.99
67_E	89_G	0.633	0.99
136_I	152_D	0.626	0.98
137_E	156_A	0.624	0.98
26_A	29_Y	0.620	0.98
31_G	34_A	0.615	0.98
148_S	163_V	0.613	0.98
107_G	134_G	0.612	0.98
119_T	135_D	0.607	0.98
76_R	97_D	0.605	0.98
106_L	132_L	0.604	0.98
104_V	126_L	0.603	0.98
120_V	132_L	0.601	0.98
90_E	108_G	0.598	0.98
29_Y	33_H	0.596	0.98
87_V	102_H	0.595	0.98
36_W	39_V	0.590	0.98
38_H	57_A	0.588	0.98
138_I	160_V	0.587	0.98
141_N	156_A	0.583	0.98
145_G	159_T	0.582	0.98
148_S	162_G	0.581	0.98
95_G	119_T	0.580	0.97
65_G	83_G	0.576	0.97
33_H	36_W	0.572	0.97
28_T	51_T	0.572	0.97
34_A	39_V	0.570	0.97
95_G	140_A	0.569	0.97
93_V	117_H	0.568	0.97
64_T	72_A	0.568	0.97
28_T	32_L	0.567	0.97
45_L	49_W	0.567	0.97
116_R	135_D	0.565	0.97
28_T	31_G	0.564	0.97
147_A	151_T	0.562	0.97
37_A	56_V	0.561	0.97
126_L	144_V	0.560	0.97
102_H	105_T	0.559	0.97
109_N	114_V	0.558	0.97
153_D	160_V	0.552	0.97
60_V	63_L	0.551	0.97
53_G	56_V	0.549	0.97
37_A	42_A	0.548	0.96
28_T	55_L	0.546	0.96
74_I	88_I	0.543	0.96
42_A	47_D	0.542	0.96
121_R	139_G	0.538	0.96
139_G	142_A	0.537	0.96
162_G	165_A	0.536	0.96
150_V	162_G	0.536	0.96
159_T	168_V	0.533	0.96
85_G	102_H	0.533	0.96
41_L	48_R	0.530	0.96
50_P	54_R	0.528	0.96
77_R	96_D	0.525	0.96
154_V	165_A	0.523	0.95
81_D	99_H	0.522	0.95
49_W	52_A	0.521	0.95
91_T	117_H	0.521	0.95
124_V	144_V	0.511	0.95
66_I	84_H	0.510	0.95
128_A	131_T	0.507	0.95
72_A	88_I	0.506	0.95
150_V	165_A	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4n6aA	3	0.9825	100	0.264	Contact Map
4h7oA	6	1	100	0.293	Contact Map
1ssqA	6	1	100	0.302	Contact Map
3q1xA	3	0.9415	100	0.304	Contact Map
4hzdA	5	1	100	0.325	Contact Map
3f1xA	6	0.9415	100	0.325	Contact Map
3srtA	3	0.9708	100	0.343	Contact Map
2p2oA	3	0.9591	100	0.345	Contact Map
3hjjA	3	0.9708	100	0.346	Contact Map
3fttA	3	0.9649	100	0.353	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.