Q9HPS8 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPS8 - Uncharacterized protein

UniProt:	Q9HPS8	Sequences: MALDQQTELSRAETDAVLARNETGVLSLARGDEPYAIPISYGYDAESRTVFLRLVSTPDSEKRAFLSSSPAVRLVVSEESPPEYRSVVAQGTLTEISTDEMTVERIEQFGDAKRPLFEIWGADKPDLRIQLYECDATTISGRCIELDHAAYA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	152 (135)
Sequences:	1249 (1048)
Seq/√Len:	90.2

HALSA - Q9HPS8 Q9HPI5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_S	36_A	3.584	1.00
93_L	132_Y	3.565	1.00
94_T	133_E	2.908	1.00
28_L	65_F	2.784	1.00
94_T	135_D	2.773	1.00
25_V	75_V	2.667	1.00
21_N	41_Y	2.578	1.00
72_V	134_C	2.518	1.00
49_T	133_E	2.517	1.00
25_V	77_S	2.472	1.00
25_V	36_A	2.468	1.00
18_L	76_V	2.399	1.00
28_L	72_V	2.250	1.00
39_I	52_L	2.249	1.00
54_L	63_R	2.228	1.00
24_G	74_L	2.124	1.00
95_E	130_Q	2.005	1.00
93_L	134_C	1.994	1.00
16_A	20_R	1.848	1.00
72_V	93_L	1.713	1.00
33_E	71_A	1.710	1.00
61_E	90_Q	1.697	1.00
63_R	132_Y	1.695	1.00
23_T	77_S	1.641	1.00
29_A	69_S	1.633	1.00
78_E	85_R	1.597	1.00
37_I	88_V	1.564	1.00
41_Y	76_V	1.561	1.00
13_E	143_C	1.457	0.99
42_G	112_A	1.446	0.99
11_R	15_D	1.436	0.99
89_A	139_I	1.426	0.99
101_M	133_E	1.402	0.99
44_D	108_Q	1.364	0.99
106_I	129_I	1.351	0.99
81_P	144_I	1.334	0.99
73_R	88_V	1.318	0.99
90_Q	138_T	1.311	0.99
50_V	74_L	1.302	0.99
103_V	107_E	1.273	0.99
52_L	132_Y	1.272	0.99
42_G	105_R	1.259	0.98
44_D	104_E	1.242	0.98
50_V	89_A	1.218	0.98
14_T	87_V	1.198	0.98
70_P	92_T	1.183	0.98
21_N	76_V	1.182	0.98
117_F	121_G	1.176	0.98
33_E	61_E	1.167	0.97
50_V	136_A	1.160	0.97
73_R	90_Q	1.152	0.97
66_L	93_L	1.142	0.97
22_E	80_S	1.130	0.97
29_A	33_E	1.115	0.97
63_R	67_S	1.100	0.96
41_Y	74_L	1.072	0.96
63_R	130_Q	1.060	0.96
6_Q	9_L	1.055	0.95
24_G	89_A	1.054	0.95
92_T	137_T	1.048	0.95
30_R	33_E	1.042	0.95
15_D	46_E	1.032	0.95
49_T	135_D	1.031	0.95
36_A	75_V	1.029	0.95
64_A	67_S	1.001	0.94
33_E	90_Q	1.001	0.94
95_E	132_Y	0.995	0.94
15_D	43_Y	0.995	0.94
29_A	65_F	0.994	0.94
123_D	126_D	0.990	0.94
30_R	61_E	0.985	0.93
84_Y	144_I	0.982	0.93
27_S	88_V	0.974	0.93
91_G	134_C	0.969	0.93
13_E	85_R	0.955	0.92
65_F	90_Q	0.953	0.92
42_G	108_Q	0.936	0.92
41_Y	113_K	0.936	0.92
71_A	92_T	0.920	0.91
136_A	139_I	0.917	0.91
67_S	130_Q	0.915	0.91
38_P	75_V	0.908	0.90
123_D	127_L	0.889	0.89
107_E	122_A	0.885	0.89
38_P	88_V	0.884	0.89
61_E	65_F	0.867	0.88
9_L	143_C	0.863	0.88
101_M	105_R	0.844	0.87
9_L	17_V	0.831	0.86
85_R	143_C	0.831	0.86
67_S	95_E	0.822	0.85
33_E	65_F	0.821	0.85
26_L	39_I	0.813	0.85
54_L	132_Y	0.810	0.84
53_R	142_R	0.809	0.84
118_E	122_A	0.796	0.83
111_D	118_E	0.793	0.83
89_A	136_A	0.790	0.83
8_E	11_R	0.788	0.83
32_D	71_A	0.781	0.82
110_G	114_R	0.778	0.82
49_T	136_A	0.777	0.82
77_S	80_S	0.771	0.81
122_A	126_D	0.770	0.81
102_T	131_L	0.770	0.81
40_S	80_S	0.766	0.81
14_T	141_G	0.765	0.81
121_G	126_D	0.762	0.81
35_Y	61_E	0.752	0.80
16_A	92_T	0.752	0.80
15_D	19_A	0.749	0.80
52_L	134_C	0.742	0.79
28_L	134_C	0.736	0.78
13_E	43_Y	0.734	0.78
12_A	31_G	0.730	0.78
36_A	77_S	0.728	0.78
74_L	89_A	0.719	0.77
19_A	43_Y	0.718	0.77
102_T	106_I	0.718	0.77
40_S	82_P	0.716	0.76
34_P	91_G	0.715	0.76
10_S	13_E	0.715	0.76
17_V	85_R	0.703	0.75
66_L	132_Y	0.693	0.74
105_R	131_L	0.689	0.74
66_L	95_E	0.688	0.74
106_I	131_L	0.683	0.73
31_G	68_S	0.677	0.72
30_R	65_F	0.676	0.72
83_E	144_I	0.674	0.72
57_T	128_R	0.673	0.72
71_A	137_T	0.667	0.71
29_A	32_D	0.666	0.71
40_S	113_K	0.663	0.71
104_E	108_Q	0.661	0.71
82_P	113_K	0.660	0.70
54_L	130_Q	0.660	0.70
84_Y	142_R	0.658	0.70
12_A	16_A	0.658	0.70
124_K	128_R	0.650	0.69
10_S	14_T	0.646	0.69
100_E	104_E	0.643	0.68
89_A	134_C	0.640	0.68
16_A	19_A	0.639	0.68
24_G	76_V	0.638	0.68
36_A	73_R	0.637	0.68
34_P	69_S	0.632	0.67
28_L	37_I	0.627	0.67
105_R	109_F	0.627	0.67
70_P	94_T	0.615	0.65
81_P	84_Y	0.609	0.64
65_F	141_G	0.607	0.64
51_F	101_M	0.598	0.63
7_T	10_S	0.598	0.63
14_T	139_I	0.597	0.63
24_G	112_A	0.596	0.63
7_T	144_I	0.592	0.62
18_L	74_L	0.591	0.62
42_G	82_P	0.589	0.62
28_L	66_L	0.589	0.62
108_Q	111_D	0.588	0.62
33_E	69_S	0.588	0.62
16_A	135_D	0.584	0.61
33_E	137_T	0.582	0.61
50_V	141_G	0.582	0.61
7_T	14_T	0.580	0.61
21_N	78_E	0.578	0.60
40_S	110_G	0.577	0.60
56_S	128_R	0.574	0.60
107_E	111_D	0.568	0.59
102_T	130_Q	0.568	0.59
13_E	16_A	0.566	0.59
44_D	49_T	0.555	0.57
25_V	88_V	0.552	0.57
60_S	106_I	0.547	0.56
101_M	104_E	0.543	0.56
20_R	78_E	0.543	0.56
18_L	43_Y	0.542	0.55
67_S	135_D	0.539	0.55
120_W	124_K	0.539	0.55
27_S	141_G	0.537	0.55
17_V	61_E	0.536	0.55
63_R	95_E	0.535	0.54
18_L	24_G	0.533	0.54
74_L	136_A	0.531	0.54
42_G	49_T	0.528	0.54
23_T	80_S	0.527	0.53
17_V	78_E	0.525	0.53
32_D	104_E	0.517	0.52
45_A	125_P	0.516	0.52
16_A	57_T	0.516	0.52
103_V	123_D	0.516	0.52
53_R	60_S	0.515	0.52
40_S	55_V	0.512	0.51
56_S	130_Q	0.512	0.51
76_V	136_A	0.510	0.51
99_D	103_V	0.507	0.51
46_E	104_E	0.507	0.51
60_S	142_R	0.504	0.50
23_T	36_A	0.504	0.50
52_L	62_K	0.500	0.50
82_P	142_R	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2htiA	2	0.8289	100	0.41	Contact Map
2ol5A	2	0.9276	100	0.413	Contact Map
2vpaA	2	0.9803	100	0.416	Contact Map
2furA	2	0.9408	100	0.419	Contact Map
2fg9A	4	0.9539	100	0.437	Contact Map
3fkhA	2	0.875	99.9	0.477	Contact Map
3cp3A	2	0.8224	99.9	0.483	Contact Map
3u5wA	2	0.8092	99.9	0.483	Contact Map
2hq9A	2	0.8618	99.9	0.49	Contact Map
1rfeA	1	0.9605	99.9	0.507	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.