Q9HPS7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPS7 - Bacterio-opsin activator-like protein

UniProt:	Q9HPS7	Sequences: MPAGIRVTVSFPRPPVCPIAVLSERANTTITNVSTSIAADGAPVTEFLIDADAVPDDYDRDPVFTYTDRHLYRVRHDAEAACPCVCLGAHDTPVNRYRARDGELQIVFHGREFDTVQAIVGELRAEFADIDIQRLVRAPTGTAAQDTAFVDRGQLTDRQLEVLTTAYEAGYFERPRGATAQALADDLGIAPSTFTEHLLAAQRKLLGDALETDGT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	215 (196)
Sequences:	1824 (1420)
Seq/√Len:	101.5

HALSA - Q9HPS7 Q9HR58 Q9HSR5 Q9HSM9 O54637 Q9HQD9 DMSR Q9HQU9
SULSO - Q97YL7 Q97X87 Q97YT8 Q97Y14 Q7LXI8 Q97WR0 Q97UD7 Q97ZB6 Q97ZX5 Q97UC0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
178_A	183_L	4.462	1.00
172_F	202_Q	4.457	1.00
165_T	169_A	4.094	1.00
169_A	183_L	3.416	1.00
190_A	193_T	3.407	1.00
162_V	187_L	3.285	1.00
87_L	92_T	3.044	1.00
158_R	197_H	2.977	1.00
193_T	197_H	2.972	1.00
167_Y	207_G	2.811	1.00
173_E	177_G	2.810	1.00
169_A	186_D	2.789	1.00
92_T	110_G	2.771	1.00
179_T	182_A	2.764	1.00
165_T	183_L	2.724	1.00
178_A	182_A	2.690	1.00
23_S	102_G	2.367	1.00
158_R	162_V	2.349	1.00
180_A	194_F	2.311	1.00
47_F	74_V	2.253	1.00
174_R	195_T	2.228	1.00
10_S	103_E	2.223	1.00
160_L	164_T	2.100	1.00
158_R	161_E	2.005	1.00
189_I	194_F	1.948	1.00
197_H	200_A	1.874	1.00
77_D	132_I	1.772	1.00
162_V	197_H	1.742	1.00
191_P	195_T	1.741	1.00
180_A	195_T	1.725	1.00
95_N	109_H	1.651	1.00
183_L	194_F	1.642	1.00
163_L	206_L	1.639	1.00
176_R	199_L	1.563	1.00
182_A	185_D	1.527	1.00
169_A	178_A	1.510	1.00
185_D	188_G	1.497	1.00
63_V	71_L	1.488	1.00
112_E	115_T	1.473	1.00
54_V	57_D	1.455	1.00
197_H	204_K	1.432	1.00
170_G	177_G	1.413	1.00
118_A	121_G	1.409	1.00
167_Y	210_L	1.402	1.00
206_L	209_A	1.381	1.00
62_P	72_Y	1.377	0.99
152_R	209_A	1.375	0.99
178_A	186_D	1.357	0.99
196_E	200_A	1.356	0.99
174_R	196_E	1.344	0.99
7_V	116_V	1.325	0.99
162_V	189_I	1.316	0.99
192_S	196_E	1.310	0.99
10_S	131_D	1.302	0.99
22_L	26_A	1.290	0.99
163_L	172_F	1.280	0.99
9_V	108_F	1.266	0.99
184_A	194_F	1.225	0.99
187_L	194_F	1.223	0.99
50_D	69_R	1.221	0.99
61_D	178_A	1.213	0.99
18_P	22_L	1.206	0.99
17_C	23_S	1.199	0.99
33_V	48_L	1.198	0.99
180_A	197_H	1.195	0.99
110_G	131_D	1.187	0.98
193_T	196_E	1.159	0.98
205_L	209_A	1.159	0.98
162_V	183_L	1.149	0.98
10_S	133_Q	1.148	0.98
120_V	130_I	1.141	0.98
162_V	201_A	1.140	0.98
22_L	54_V	1.118	0.98
123_L	128_A	1.118	0.98
171_Y	176_R	1.110	0.98
37_I	40_D	1.078	0.97
164_T	168_E	1.077	0.97
203_R	207_G	1.071	0.97
193_T	198_L	1.071	0.97
17_C	20_A	1.070	0.97
174_R	192_S	1.057	0.97
155_L	201_A	1.054	0.97
174_R	199_L	1.044	0.97
9_V	32_N	1.033	0.96
45_T	76_H	1.033	0.96
32_N	35_T	1.018	0.96
172_F	198_L	1.012	0.96
59_D	62_P	1.012	0.96
23_S	103_E	1.008	0.96
181_Q	191_P	1.005	0.96
96_R	172_F	0.993	0.95
121_G	125_A	0.992	0.95
115_T	118_A	0.991	0.95
21_V	26_A	0.988	0.95
167_Y	172_F	0.984	0.95
193_T	201_A	0.975	0.95
19_I	22_L	0.966	0.95
8_T	105_Q	0.965	0.95
132_I	135_L	0.960	0.95
62_P	70_H	0.957	0.94
162_V	194_F	0.956	0.94
45_T	48_L	0.952	0.94
9_V	120_V	0.943	0.94
198_L	202_Q	0.940	0.94
26_A	52_D	0.930	0.94
172_F	201_A	0.929	0.94
117_Q	120_V	0.924	0.93
48_L	69_R	0.917	0.93
62_P	65_T	0.914	0.93
109_H	172_F	0.913	0.93
131_D	139_P	0.911	0.93
190_A	199_L	0.909	0.93
85_V	89_A	0.905	0.93
103_E	149_F	0.903	0.93
154_Q	208_D	0.902	0.93
180_A	191_P	0.891	0.92
169_A	194_F	0.884	0.92
15_P	189_I	0.881	0.92
25_R	210_L	0.875	0.91
63_V	111_R	0.875	0.91
105_Q	133_Q	0.871	0.91
94_V	108_F	0.867	0.91
174_R	181_Q	0.866	0.91
180_A	193_T	0.861	0.91
174_R	203_R	0.860	0.91
32_N	47_F	0.858	0.91
206_L	210_L	0.850	0.90
98_R	105_Q	0.849	0.90
158_R	196_E	0.845	0.90
14_P	17_C	0.841	0.90
174_R	197_H	0.840	0.90
165_T	186_D	0.839	0.90
171_Y	180_A	0.838	0.89
172_F	180_A	0.834	0.89
22_L	56_D	0.832	0.89
205_L	208_D	0.829	0.89
111_R	124_R	0.822	0.89
25_R	53_A	0.807	0.88
97_Y	106_I	0.807	0.88
45_T	74_V	0.802	0.87
104_L	107_V	0.797	0.87
183_L	187_L	0.796	0.87
161_E	164_T	0.790	0.87
173_E	203_R	0.784	0.86
180_A	201_A	0.772	0.85
7_V	10_S	0.771	0.85
58_Y	77_D	0.770	0.85
91_D	112_E	0.768	0.85
191_P	200_A	0.763	0.85
33_V	71_L	0.760	0.84
30_I	49_I	0.758	0.84
49_I	70_H	0.753	0.84
181_Q	199_L	0.753	0.84
135_L	171_Y	0.752	0.84
76_H	84_C	0.745	0.83
119_I	196_E	0.738	0.83
9_V	102_G	0.727	0.82
118_A	177_G	0.725	0.81
92_T	96_R	0.724	0.81
132_I	189_I	0.723	0.81
90_H	122_E	0.719	0.81
110_G	172_F	0.703	0.79
135_L	192_S	0.702	0.79
88_G	183_L	0.700	0.79
53_A	56_D	0.700	0.79
27_N	52_D	0.699	0.79
91_D	122_E	0.695	0.79
82_C	85_V	0.694	0.79
67_T	70_H	0.691	0.78
35_T	161_E	0.689	0.78
56_D	61_D	0.687	0.78
13_R	104_L	0.681	0.77
30_I	119_I	0.679	0.77
70_H	73_R	0.673	0.76
81_A	172_F	0.669	0.76
200_A	203_R	0.664	0.75
44_V	133_Q	0.663	0.75
178_A	194_F	0.663	0.75
161_E	165_T	0.662	0.75
56_D	95_N	0.662	0.75
24_E	112_E	0.660	0.75
134_R	183_L	0.659	0.75
94_V	118_A	0.658	0.75
116_V	161_E	0.656	0.75
167_Y	206_L	0.655	0.74
71_L	200_A	0.655	0.74
58_Y	61_D	0.650	0.74
37_I	106_I	0.649	0.74
59_D	118_A	0.648	0.74
189_I	197_H	0.646	0.73
32_N	109_H	0.643	0.73
131_D	203_R	0.643	0.73
56_D	87_L	0.642	0.73
99_A	104_L	0.638	0.73
21_V	24_E	0.635	0.72
170_G	173_E	0.632	0.72
40_D	43_P	0.630	0.72
201_A	206_L	0.628	0.71
17_C	83_P	0.623	0.71
69_R	72_Y	0.623	0.71
32_N	113_F	0.622	0.71
119_I	191_P	0.620	0.70
137_R	154_Q	0.618	0.70
44_V	93_P	0.618	0.70
94_V	152_R	0.616	0.70
28_T	51_A	0.615	0.70
165_T	187_L	0.613	0.70
57_D	63_V	0.611	0.69
20_A	23_S	0.609	0.69
86_C	126_E	0.604	0.68
55_P	58_Y	0.604	0.68
96_R	187_L	0.603	0.68
19_I	74_V	0.602	0.68
182_A	187_L	0.601	0.68
96_R	202_Q	0.599	0.68
128_A	136_V	0.598	0.68
7_V	135_L	0.598	0.68
18_P	30_I	0.589	0.66
84_C	194_F	0.589	0.66
95_N	179_T	0.588	0.66
30_I	200_A	0.588	0.66
124_R	189_I	0.588	0.66
57_D	62_P	0.588	0.66
24_E	102_G	0.587	0.66
27_N	127_F	0.587	0.66
175_P	199_L	0.582	0.66
6_R	136_V	0.581	0.65
9_V	106_I	0.575	0.65
42_A	53_A	0.574	0.64
49_I	155_L	0.574	0.64
163_L	210_L	0.573	0.64
69_R	179_T	0.573	0.64
164_T	210_L	0.572	0.64
113_F	135_L	0.570	0.64
170_G	195_T	0.569	0.64
44_V	103_E	0.568	0.64
37_I	43_P	0.567	0.64
20_A	57_D	0.565	0.63
89_A	169_A	0.565	0.63
112_E	160_L	0.565	0.63
93_P	109_H	0.559	0.62
120_V	171_Y	0.558	0.62
26_A	51_A	0.556	0.62
85_V	91_D	0.556	0.62
33_V	188_G	0.556	0.62
167_Y	209_A	0.555	0.62
90_H	156_T	0.554	0.62
156_T	204_K	0.553	0.62
189_I	192_S	0.552	0.61
66_Y	209_A	0.552	0.61
28_T	49_I	0.551	0.61
193_T	200_A	0.549	0.61
159_Q	204_K	0.547	0.61
63_V	165_T	0.545	0.61
193_T	209_A	0.545	0.61
24_E	56_D	0.543	0.60
29_T	161_E	0.543	0.60
69_R	157_D	0.543	0.60
160_L	209_A	0.541	0.60
141_G	201_A	0.538	0.60
161_E	194_F	0.537	0.59
44_V	76_H	0.536	0.59
158_R	202_Q	0.536	0.59
112_E	148_A	0.534	0.59
13_R	18_P	0.531	0.59
7_V	113_F	0.531	0.59
176_R	205_L	0.530	0.58
117_Q	193_T	0.529	0.58
171_Y	198_L	0.528	0.58
113_F	190_A	0.527	0.58
32_N	46_E	0.527	0.58
6_R	202_Q	0.525	0.58
74_V	154_Q	0.523	0.57
152_R	160_L	0.520	0.57
44_V	156_T	0.519	0.57
72_Y	115_T	0.517	0.57
108_F	204_K	0.515	0.56
23_S	26_A	0.515	0.56
24_E	31_T	0.513	0.56
153_G	209_A	0.507	0.55
80_A	172_F	0.507	0.55
13_R	17_C	0.507	0.55
41_G	123_L	0.506	0.55
124_R	177_G	0.505	0.55
87_L	106_I	0.505	0.55
58_Y	133_Q	0.504	0.55
37_I	84_C	0.504	0.55
172_F	206_L	0.504	0.55
112_E	149_F	0.503	0.55
113_F	116_V	0.503	0.55
154_Q	207_G	0.503	0.55
102_G	125_A	0.503	0.55
77_D	87_L	0.502	0.54
92_T	97_Y	0.500	0.54

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ku3A	1	0.2837	97.6	0.838	Contact Map
1s7oA	3	0.3302	97.5	0.844	Contact Map
4wszA	2	0.2698	97.4	0.846	Contact Map
1je8A	2	0.2744	97.3	0.847	Contact Map
1xsvA	2	0.3256	97.3	0.849	Contact Map
3c57A	2	0.2326	97.2	0.85	Contact Map
2o8xA	7	0.2837	97.2	0.85	Contact Map
3hugA	3	0.3674	97.2	0.851	Contact Map
1x3uA	1	0.3209	97.1	0.852	Contact Map
3t72q	1	0.3302	97.1	0.854	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.