Q9HPS5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPS5 - Uncharacterized protein

UniProt:	Q9HPS5	Sequences: MGMADGFVRRHVAGLAAVLGVASIAVVVAAVRGVIPAGVLPQAPAWFIGAIPPLNAVISAAAIGTILAGWRWIRRGDVAKHRAAMATTTLLFVAFLGLYLYRLVVHGTTAFPTTGAVYTFVYLPVLIIHMGLAIACIPLVYYVLLLAGTRPVSEIYDSNHARVGRVAASLWLVSFALGIVVYLMLYVLY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	189 (171)
Sequences:	437 (308)
Seq/√Len:	23.5

BACSU - YOZB
HALSA - Q9HPS5 Q9HRJ3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
111_F	117_V	6.756	1.00
143_V	164_G	5.722	1.00
22_A	26_V	3.772	1.00
73_I	78_V	3.308	1.00
69_G	85_M	3.217	1.00
118_Y	123_L	2.974	1.00
116_A	121_V	2.889	0.99
18_V	22_A	2.860	0.99
79_A	83_A	2.520	0.99
72_W	84_A	2.251	0.97
147_A	152_V	2.230	0.97
72_W	80_K	2.205	0.97
70_W	76_G	2.160	0.96
65_T	91_L	2.105	0.95
113_T	116_A	2.009	0.94
143_V	167_A	1.954	0.93
164_G	167_A	1.915	0.92
86_A	148_G	1.858	0.91
137_I	140_V	1.712	0.87
12_V	23_S	1.694	0.87
131_G	134_I	1.690	0.87
55_N	175_F	1.654	0.85
30_A	35_I	1.626	0.84
63_I	176_A	1.612	0.84
92_F	175_F	1.599	0.83
116_A	120_F	1.584	0.83
67_L	172_L	1.573	0.82
19_L	23_S	1.555	0.82
109_T	185_L	1.502	0.79
67_L	71_R	1.448	0.77
23_S	26_V	1.442	0.76
24_I	27_V	1.424	0.75
65_T	84_A	1.421	0.75
114_T	117_V	1.395	0.74
16_A	20_G	1.375	0.73
14_G	18_V	1.369	0.73
124_P	128_I	1.351	0.71
85_M	147_A	1.335	0.71
16_A	23_S	1.327	0.70
62_A	137_I	1.312	0.69
69_G	87_T	1.308	0.69
90_L	176_A	1.279	0.67
48_I	101_Y	1.278	0.67
24_I	28_V	1.265	0.66
13_A	150_R	1.258	0.66
146_L	164_G	1.257	0.66
27_V	30_A	1.234	0.64
25_A	75_R	1.229	0.64
17_A	20_G	1.227	0.64
169_S	173_V	1.215	0.63
21_V	25_A	1.215	0.63
93_V	97_G	1.212	0.63
16_A	30_A	1.208	0.63
12_V	22_A	1.208	0.63
77_D	80_K	1.194	0.62
11_H	14_G	1.194	0.62
77_D	153_S	1.178	0.61
117_V	121_V	1.173	0.60
120_F	124_P	1.162	0.60
142_Y	147_A	1.160	0.59
136_C	170_L	1.149	0.59
15_L	19_L	1.149	0.59
92_F	168_A	1.147	0.59
70_W	74_R	1.142	0.58
17_A	21_V	1.134	0.58
53_P	57_V	1.121	0.57
54_L	98_L	1.121	0.57
123_L	127_I	1.104	0.56
142_Y	145_L	1.091	0.55
134_I	142_Y	1.058	0.52
117_V	180_V	1.052	0.52
123_L	185_L	1.048	0.52
111_F	184_M	1.033	0.51
101_Y	144_L	1.033	0.51
26_V	29_A	1.030	0.50
125_V	139_L	1.030	0.50
34_V	40_L	1.028	0.50
139_L	170_L	1.027	0.50
116_A	128_I	1.027	0.50
111_F	120_F	1.017	0.49
82_R	86_A	1.014	0.49
148_G	151_P	1.003	0.49
136_C	164_G	1.002	0.48
102_R	185_L	0.995	0.48
12_V	16_A	0.994	0.48
70_W	168_A	0.989	0.48
55_N	98_L	0.989	0.48
85_M	91_L	0.987	0.47
51_I	102_R	0.986	0.47
18_V	23_S	0.976	0.47
68_A	90_L	0.976	0.47
145_L	149_T	0.969	0.46
15_L	22_A	0.965	0.46
62_A	140_V	0.964	0.46
60_A	179_I	0.963	0.46
45_A	48_I	0.960	0.45
58_I	98_L	0.956	0.45
28_V	100_L	0.951	0.45
12_V	19_L	0.946	0.45
46_W	50_A	0.945	0.44
148_G	163_V	0.937	0.44
102_R	109_T	0.937	0.44
83_A	87_T	0.929	0.43
20_G	24_I	0.924	0.43
115_G	124_P	0.923	0.43
18_V	26_V	0.923	0.43
91_L	175_F	0.916	0.42
59_S	66_I	0.907	0.42
132_L	165_R	0.906	0.42
86_A	144_L	0.898	0.41
36_P	40_L	0.886	0.40
12_V	26_V	0.877	0.40
169_S	174_S	0.876	0.40
52_P	181_V	0.871	0.39
16_A	22_A	0.867	0.39
112_P	115_G	0.866	0.39
159_N	162_R	0.864	0.39
60_A	163_V	0.857	0.38
20_G	94_A	0.844	0.38
67_L	176_A	0.838	0.37
77_D	83_A	0.832	0.37
65_T	88_T	0.824	0.36
74_R	78_V	0.822	0.36
136_C	139_L	0.821	0.36
79_A	162_R	0.821	0.36
134_I	149_T	0.810	0.35
16_A	26_V	0.804	0.35
127_I	149_T	0.804	0.35
45_A	111_F	0.803	0.35
173_V	177_L	0.800	0.35
22_A	27_V	0.796	0.34
63_I	92_F	0.793	0.34
142_Y	163_V	0.789	0.34
54_L	58_I	0.787	0.34
69_G	89_T	0.781	0.34
70_W	128_I	0.774	0.33
16_A	24_I	0.774	0.33
14_G	17_A	0.774	0.33
28_V	183_L	0.773	0.33
57_V	88_T	0.772	0.33
75_R	87_T	0.766	0.33
25_A	135_A	0.762	0.32
83_A	86_A	0.759	0.32
20_G	27_V	0.759	0.32
32_R	135_A	0.746	0.31
92_F	138_P	0.741	0.31
73_I	90_L	0.739	0.31
63_I	172_L	0.732	0.31
109_T	186_Y	0.728	0.30
74_R	79_A	0.721	0.30
55_N	133_A	0.720	0.30
11_H	100_L	0.713	0.29
18_V	21_V	0.709	0.29
171_W	178_G	0.704	0.29
143_V	146_L	0.703	0.29
110_A	120_F	0.700	0.29
10_R	22_A	0.698	0.29
71_R	121_V	0.696	0.28
23_S	30_A	0.693	0.28
110_A	135_A	0.689	0.28
114_T	123_L	0.687	0.28
68_A	153_S	0.683	0.28
29_A	100_L	0.682	0.28
73_I	125_V	0.680	0.28
128_I	177_L	0.679	0.27
53_P	143_V	0.670	0.27
25_A	78_V	0.667	0.27
77_D	163_V	0.662	0.27
168_A	172_L	0.655	0.26
63_I	101_Y	0.654	0.26
147_A	150_R	0.654	0.26
61_A	65_T	0.651	0.26
89_T	93_V	0.651	0.26
15_L	23_S	0.651	0.26
153_S	163_V	0.651	0.26
74_R	118_Y	0.651	0.26
24_I	31_V	0.650	0.26
18_V	77_D	0.649	0.26
174_S	177_L	0.647	0.26
121_V	150_R	0.646	0.26
150_R	166_V	0.642	0.25
22_A	90_L	0.642	0.25
59_S	141_Y	0.641	0.25
115_G	127_I	0.638	0.25
175_F	179_I	0.637	0.25
51_I	98_L	0.637	0.25
127_I	131_G	0.634	0.25
70_W	78_V	0.632	0.25
152_V	161_A	0.627	0.25
93_V	144_L	0.627	0.25
108_T	123_L	0.626	0.25
149_T	153_S	0.625	0.25
108_T	185_L	0.625	0.25
78_V	89_T	0.622	0.24
29_A	33_G	0.620	0.24
135_A	170_L	0.618	0.24
125_V	179_I	0.614	0.24
134_I	159_N	0.613	0.24
13_A	23_S	0.604	0.23
106_H	133_A	0.602	0.23
142_Y	151_P	0.602	0.23
91_L	145_L	0.599	0.23
107_G	180_V	0.597	0.23
56_A	84_A	0.595	0.23
22_A	25_A	0.593	0.23
86_A	145_L	0.593	0.23
102_R	105_V	0.588	0.23
54_L	82_R	0.586	0.23
51_I	59_S	0.586	0.23
85_M	90_L	0.586	0.23
83_A	116_A	0.576	0.22
69_G	106_H	0.576	0.22
16_A	25_A	0.576	0.22
54_L	67_L	0.574	0.22
40_L	133_A	0.569	0.22
27_V	31_V	0.564	0.22
139_L	177_L	0.563	0.21
12_V	145_L	0.563	0.21
22_A	32_R	0.560	0.21
53_P	164_G	0.558	0.21
35_I	123_L	0.554	0.21
64_G	180_V	0.554	0.21
55_N	63_I	0.553	0.21
139_L	150_R	0.552	0.21
29_A	32_R	0.551	0.21
90_L	94_A	0.550	0.21
29_A	57_V	0.550	0.21
14_G	21_V	0.548	0.21
163_V	167_A	0.547	0.21
31_V	55_N	0.543	0.21
29_A	36_P	0.542	0.20
58_I	94_A	0.542	0.20
85_M	92_F	0.541	0.20
46_W	133_A	0.540	0.20
35_I	60_A	0.539	0.20
33_G	36_P	0.539	0.20
59_S	92_F	0.537	0.20
169_S	187_V	0.537	0.20
25_A	28_V	0.537	0.20
88_T	139_L	0.531	0.20
91_L	140_V	0.526	0.20
48_I	134_I	0.525	0.20
68_A	116_A	0.524	0.20
76_G	83_A	0.524	0.20
89_T	140_V	0.524	0.20
161_A	172_L	0.523	0.20
66_I	179_I	0.519	0.19
64_G	116_A	0.517	0.19
114_T	120_F	0.516	0.19
30_A	172_L	0.516	0.19
140_V	168_A	0.512	0.19
84_A	87_T	0.512	0.19
103_L	108_T	0.508	0.19
128_I	164_G	0.508	0.19
21_V	131_G	0.503	0.19
30_A	36_P	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1fftC	1	0.9101	94.6	0.912	Contact Map
1v54C	1	0.963	76.9	0.936	Contact Map
1qleC	1	0.963	76.2	0.936	Contact Map
1m56C	2	0.963	75.1	0.937	Contact Map
2yevA	1	0.9524	72.6	0.938	Contact Map
4n6hA	1	0.8466	31.2	0.952	Contact Map
2nwlA	3	0.4921	28.1	0.953	Contact Map
4o6yA	2	0.8783	25.8	0.954	Contact Map
4ev6A	3	0.3757	19.9	0.956	Contact Map
4ldeA	1	0.8201	17.7	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.