Q9HPN6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPN6 - Uncharacterized protein

UniProt:	Q9HPN6	Sequences: MTLTLYALDGCPDCESVIDTLAADDIDHETVHVDARHSARNAVKRASGQRSVPVLVDDDRGVVMADSQRIQTYAAVTLA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	79 (76)
Sequences:	416 (218)
Seq/√Len:	25.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_L	55_L	3.683	1.00
20_T	75_A	3.582	1.00
47_S	65_A	2.949	1.00
73_Y	77_T	2.624	0.99
4_T	31_V	2.440	0.99
7_A	34_D	2.437	0.99
16_S	68_Q	2.355	0.98
43_V	54_V	2.165	0.97
7_A	30_T	2.143	0.97
13_D	66_D	1.796	0.91
4_T	58_D	1.789	0.91
21_L	28_H	1.760	0.90
46_A	63_V	1.655	0.87
7_A	14_C	1.563	0.84
54_V	63_V	1.398	0.77
14_C	32_H	1.361	0.75
40_R	66_D	1.346	0.74
69_R	72_T	1.320	0.72
27_D	37_H	1.314	0.72
74_A	78_L	1.302	0.71
20_T	71_Q	1.286	0.70
24_D	78_L	1.268	0.69
4_T	42_A	1.266	0.69
4_T	56_V	1.252	0.68
40_R	67_S	1.241	0.67
10_G	49_Q	1.239	0.67
6_Y	14_C	1.200	0.65
41_N	71_Q	1.189	0.64
11_C	65_A	1.122	0.59
13_D	67_S	1.065	0.55
6_Y	34_D	1.057	0.55
50_R	65_A	1.046	0.54
4_T	29_E	1.016	0.52
30_T	34_D	0.991	0.50
26_I	74_A	0.960	0.48
9_D	32_H	0.951	0.47
41_N	45_R	0.941	0.46
8_L	11_C	0.938	0.46
21_L	30_T	0.918	0.45
16_S	23_A	0.918	0.45
34_D	37_H	0.913	0.44
10_G	31_V	0.895	0.43
56_V	61_G	0.889	0.43
46_A	56_V	0.882	0.42
12_P	33_V	0.881	0.42
41_N	52_V	0.879	0.42
56_V	72_T	0.871	0.41
62_V	73_Y	0.862	0.41
7_A	28_H	0.859	0.41
68_Q	76_V	0.847	0.40
62_V	76_V	0.845	0.40
7_A	18_I	0.844	0.40
15_E	35_A	0.833	0.39
3_L	29_E	0.822	0.38
72_T	77_T	0.821	0.38
22_A	25_D	0.821	0.38
13_D	40_R	0.804	0.37
14_C	30_T	0.793	0.36
15_E	19_D	0.784	0.35
43_V	52_V	0.771	0.35
13_D	35_A	0.761	0.34
25_D	32_H	0.758	0.34
29_E	43_V	0.755	0.34
8_L	37_H	0.755	0.34
57_D	78_L	0.753	0.33
33_V	43_V	0.750	0.33
9_D	19_D	0.746	0.33
8_L	35_A	0.738	0.32
61_G	72_T	0.736	0.32
42_A	45_R	0.731	0.32
6_Y	31_V	0.718	0.31
7_A	32_H	0.710	0.31
8_L	12_P	0.707	0.31
56_V	77_T	0.695	0.30
49_Q	65_A	0.694	0.30
35_A	59_D	0.693	0.30
21_L	39_A	0.679	0.29
38_S	41_N	0.669	0.28
51_S	65_A	0.669	0.28
15_E	32_H	0.665	0.28
11_C	27_D	0.664	0.28
10_G	16_S	0.662	0.28
44_K	49_Q	0.653	0.27
9_D	74_A	0.640	0.27
31_V	42_A	0.640	0.27
9_D	59_D	0.632	0.26
11_C	14_C	0.631	0.26
38_S	50_R	0.622	0.26
38_S	45_R	0.620	0.25
25_D	75_A	0.618	0.25
56_V	63_V	0.617	0.25
42_A	46_A	0.611	0.25
71_Q	74_A	0.609	0.25
13_D	33_V	0.607	0.25
51_S	54_V	0.606	0.25
45_R	77_T	0.600	0.24
19_D	32_H	0.593	0.24
7_A	15_E	0.572	0.23
45_R	64_M	0.567	0.23
5_L	55_L	0.565	0.23
24_D	27_D	0.559	0.22
40_R	43_V	0.558	0.22
15_E	18_I	0.555	0.22
54_V	65_A	0.554	0.22
21_L	55_L	0.550	0.22
10_G	22_A	0.549	0.22
6_Y	50_R	0.548	0.22
41_N	56_V	0.539	0.21
18_I	32_H	0.535	0.21
43_V	47_S	0.531	0.21
56_V	65_A	0.520	0.20
12_P	67_S	0.519	0.20
21_L	42_A	0.507	0.20
26_I	29_E	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kh7A	2	1	99.4	0.575	Contact Map
3wywA	2	0.9747	99.4	0.583	Contact Map
4igjA	2	0.9241	99.4	0.587	Contact Map
4ielA	2	0.9747	99.4	0.588	Contact Map
4mpgA	2	0.9747	99.4	0.589	Contact Map
3vk9A	2	0.9747	99.4	0.589	Contact Map
3m0fA	2	0.9494	99.4	0.59	Contact Map
3nivA	2	0.7722	99.4	0.59	Contact Map
1gnwA	2	0.962	99.4	0.592	Contact Map
4agsA	3	1	99.4	0.592	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.