CBIT - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CBIT - Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)

UniProt:	Q9HPN4	Sequences: MAQTQLPHDAKAGPTKPEVRAVVRSKLALTDDDHFVEVGSCTGAVTIAAARDAGRVTALERKADRLETTRKNLAANGLADAVELRNAEAPAELPADADALFIGGSRNYDAVLDHAAETGVDRIVMNVSRLEVAGAATQAFRDRDILTEVVQFQVSHGYELAGATSFDSENPVYMLVGSASGDTEADR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	187 (171)
Sequences:	1917 (1297)
Seq/√Len:	99.2

HALSA - CBIT
SULSO - CBIT

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_V	126_N	5.259	1.00
18_E	156_H	3.371	1.00
40_S	69_T	3.163	1.00
40_S	58_A	3.153	1.00
87_A	92_E	2.977	1.00
34_H	57_T	2.916	1.00
100_L	115_A	2.866	1.00
112_L	139_A	2.718	1.00
131_E	164_T	2.488	1.00
22_V	152_F	2.248	1.00
127_V	132_V	2.223	1.00
61_R	88_E	2.185	1.00
35_F	49_A	2.132	1.00
36_V	97_A	2.115	1.00
66_L	84_L	2.006	1.00
63_A	86_N	1.972	1.00
9_D	71_K	1.946	1.00
40_S	46_T	1.877	1.00
158_Y	167_D	1.851	1.00
73_L	82_V	1.845	1.00
29_L	49_A	1.830	1.00
125_M	136_A	1.806	1.00
14_P	42_T	1.754	1.00
67_E	71_K	1.752	1.00
17_P	26_K	1.748	1.00
71_K	74_A	1.690	1.00
50_A	82_V	1.680	1.00
34_H	55_R	1.673	1.00
109_D	142_D	1.670	1.00
33_D	99_A	1.662	1.00
96_D	118_T	1.652	1.00
66_L	86_N	1.650	1.00
40_S	60_E	1.649	1.00
38_V	89_A	1.625	1.00
126_N	174_M	1.583	1.00
165_S	170_N	1.575	1.00
58_A	69_T	1.537	1.00
70_R	74_A	1.511	1.00
70_R	86_N	1.503	1.00
123_I	177_G	1.499	1.00
59_L	92_E	1.494	1.00
45_V	101_F	1.494	1.00
55_R	83_E	1.469	1.00
18_E	26_K	1.461	1.00
106_R	132_V	1.453	1.00
30_T	33_D	1.432	1.00
139_A	143_R	1.406	1.00
46_T	82_V	1.369	0.99
99_A	122_R	1.314	0.99
61_R	106_R	1.312	0.99
116_A	177_G	1.295	0.99
9_D	68_T	1.288	0.99
166_F	173_Y	1.283	0.99
90_P	93_L	1.283	0.99
114_H	118_T	1.275	0.99
129_R	163_A	1.253	0.99
115_A	121_D	1.251	0.99
38_V	59_L	1.239	0.99
160_L	170_N	1.228	0.99
42_T	68_T	1.203	0.99
23_V	174_M	1.203	0.99
155_S	171_P	1.202	0.99
138_Q	142_D	1.182	0.98
157_G	166_F	1.180	0.98
121_D	179_A	1.176	0.98
157_G	164_T	1.175	0.98
69_T	84_L	1.168	0.98
57_T	95_A	1.137	0.98
46_T	56_V	1.133	0.98
167_D	170_N	1.128	0.98
38_V	115_A	1.103	0.97
60_E	69_T	1.096	0.97
156_H	169_E	1.093	0.97
50_A	80_D	1.084	0.97
50_A	56_V	1.071	0.97
133_A	173_Y	1.057	0.97
27_L	35_F	1.049	0.96
29_L	53_A	1.047	0.96
110_A	113_D	1.044	0.96
67_E	70_R	1.042	0.96
29_L	35_F	1.031	0.96
106_R	125_M	1.031	0.96
140_F	177_G	1.019	0.96
47_I	76_N	1.014	0.96
26_K	148_E	1.012	0.96
149_V	157_G	1.001	0.95
102_I	125_M	0.999	0.95
73_L	78_L	0.994	0.95
66_L	70_R	0.994	0.95
22_V	154_V	0.993	0.95
111_V	115_A	0.967	0.94
73_L	84_L	0.965	0.94
18_E	22_V	0.963	0.94
17_P	25_S	0.955	0.94
34_H	95_A	0.948	0.94
122_R	176_V	0.947	0.94
113_D	143_R	0.934	0.93
88_E	91_A	0.930	0.93
107_N	110_A	0.923	0.93
97_A	100_L	0.913	0.93
26_K	174_M	0.910	0.92
116_A	179_A	0.906	0.92
21_A	25_S	0.905	0.92
70_R	73_L	0.901	0.92
38_V	90_P	0.897	0.92
27_L	101_F	0.893	0.92
35_F	53_A	0.892	0.92
22_V	25_S	0.884	0.91
109_D	138_Q	0.884	0.91
134_G	138_Q	0.881	0.91
138_Q	141_R	0.873	0.91
131_E	163_A	0.872	0.91
10_A	14_P	0.869	0.91
7_P	51_R	0.863	0.90
136_A	175_L	0.853	0.90
93_L	114_H	0.851	0.90
125_M	132_V	0.838	0.89
23_V	101_F	0.833	0.89
63_A	67_E	0.826	0.88
124_V	174_M	0.822	0.88
14_P	44_A	0.820	0.88
151_Q	173_Y	0.809	0.87
107_N	163_A	0.797	0.86
60_E	65_R	0.795	0.86
65_R	68_T	0.793	0.86
109_D	135_A	0.791	0.86
155_S	168_S	0.791	0.86
22_V	26_K	0.790	0.86
40_S	84_L	0.787	0.86
57_T	85_R	0.784	0.85
113_D	117_E	0.780	0.85
105_S	108_Y	0.774	0.85
9_D	14_P	0.769	0.84
114_H	117_E	0.766	0.84
128_S	167_D	0.761	0.84
87_A	91_A	0.758	0.83
59_L	89_A	0.748	0.83
112_L	123_I	0.747	0.83
18_E	154_V	0.738	0.82
11_K	64_D	0.729	0.81
27_L	45_V	0.726	0.81
125_M	140_F	0.725	0.81
36_V	100_L	0.724	0.81
116_A	139_A	0.718	0.80
79_A	82_V	0.711	0.79
96_D	119_G	0.702	0.79
58_A	82_V	0.699	0.78
78_L	82_V	0.698	0.78
14_P	68_T	0.696	0.78
113_D	142_D	0.693	0.78
151_Q	155_S	0.692	0.78
22_V	126_N	0.690	0.77
44_A	68_T	0.690	0.77
6_L	10_A	0.687	0.77
12_A	65_R	0.682	0.77
27_L	122_R	0.681	0.76
151_Q	154_V	0.681	0.76
39_G	104_G	0.681	0.76
12_A	68_T	0.677	0.76
132_V	163_A	0.676	0.76
150_V	154_V	0.675	0.76
32_D	53_A	0.674	0.76
13_G	68_T	0.674	0.76
69_T	73_L	0.674	0.76
112_L	143_R	0.673	0.76
135_A	139_A	0.670	0.75
133_A	166_F	0.669	0.75
135_A	138_Q	0.668	0.75
46_T	69_T	0.666	0.75
23_V	173_Y	0.662	0.74
28_A	33_D	0.660	0.74
36_V	95_A	0.660	0.74
70_R	84_L	0.659	0.74
29_L	33_D	0.658	0.74
127_V	175_L	0.656	0.74
33_D	53_A	0.648	0.73
70_R	83_E	0.648	0.73
26_K	176_V	0.647	0.73
59_L	93_L	0.646	0.73
150_V	176_V	0.645	0.72
71_K	75_A	0.644	0.72
11_K	62_K	0.643	0.72
108_Y	132_V	0.641	0.72
59_L	87_A	0.639	0.72
19_V	126_N	0.639	0.72
133_A	149_V	0.638	0.72
46_T	76_N	0.631	0.71
17_P	169_E	0.631	0.71
18_E	150_V	0.614	0.69
19_V	172_V	0.613	0.69
9_D	42_T	0.603	0.67
62_K	65_R	0.602	0.67
91_A	94_P	0.602	0.67
55_R	95_A	0.600	0.67
45_V	49_A	0.600	0.67
141_R	159_E	0.600	0.67
67_E	86_N	0.596	0.66
51_R	76_N	0.595	0.66
14_P	65_R	0.595	0.66
20_R	72_N	0.594	0.66
110_A	114_H	0.593	0.66
108_Y	136_A	0.592	0.66
140_F	164_T	0.587	0.65
68_T	73_L	0.587	0.65
134_G	137_T	0.586	0.65
15_T	39_G	0.586	0.65
44_A	47_I	0.585	0.65
152_F	174_M	0.578	0.64
122_R	178_S	0.576	0.64
133_A	165_S	0.575	0.64
34_H	97_A	0.573	0.63
113_D	139_A	0.573	0.63
160_L	163_A	0.571	0.63
88_E	107_N	0.570	0.63
17_P	150_V	0.569	0.63
28_A	178_S	0.565	0.62
37_E	46_T	0.565	0.62
106_R	127_V	0.563	0.62
42_T	65_R	0.560	0.62
74_A	162_G	0.560	0.62
148_E	176_V	0.558	0.61
29_L	99_A	0.558	0.61
85_R	92_E	0.557	0.61
168_S	171_P	0.556	0.61
28_A	122_R	0.553	0.61
10_A	42_T	0.550	0.60
57_T	118_T	0.549	0.60
160_L	165_S	0.543	0.59
128_S	166_F	0.541	0.59
85_R	90_P	0.540	0.59
151_Q	166_F	0.539	0.59
88_E	92_E	0.533	0.58
28_A	176_V	0.533	0.58
7_P	30_T	0.531	0.58
26_K	150_V	0.530	0.58
52_D	138_Q	0.529	0.57
65_R	84_L	0.526	0.57
84_L	124_V	0.525	0.57
128_S	175_L	0.525	0.57
7_P	10_A	0.523	0.57
84_L	148_E	0.522	0.56
133_A	175_L	0.520	0.56
136_A	177_G	0.519	0.56
90_P	110_A	0.517	0.56
144_D	147_T	0.517	0.56
27_L	99_A	0.513	0.55
114_H	152_F	0.512	0.55
13_G	65_R	0.511	0.55
83_E	86_N	0.507	0.54
17_P	54_G	0.507	0.54
46_T	50_A	0.506	0.54
13_G	161_A	0.506	0.54
10_A	40_S	0.503	0.54
37_E	49_A	0.501	0.53
106_R	172_V	0.500	0.53
33_D	98_D	0.500	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2yxdA	4	0.9465	99.9	0.608	Contact Map
3hm2A	3	0.8877	99.9	0.62	Contact Map
3e05A	4	0.9626	99.9	0.625	Contact Map
1l3iA	5	0.9572	99.9	0.64	Contact Map
3njrA	4	0.9305	99.9	0.651	Contact Map
3gnlA	1	0.9144	99.8	0.719	Contact Map
1o54A	4	0.9733	99.7	0.729	Contact Map
3lecA	2	0.9305	99.7	0.732	Contact Map
3mb5A	3	0.9572	99.7	0.739	Contact Map
2pwyA	3	0.9626	99.7	0.741	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.