Q9HPM1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPM1 - Precorrin isomerase

UniProt:	Q9HPM1	Sequences: MTTDTTPDGDDEQDFESYADLGATTEKALDIAETSMDRVRELVPDETLADRLRQKSVHATGDPEFQHLLRFNGGEPVRAGARAVLDEAPIVTDITMVKAGVTGRGHDCEVRKAIGNGAELAAETGMTRTAASVLELDKQGVYDGAIAVVGNAPTAALALADCIADGTRPAVAVATPVGFVKAAESRTRLREVAAEYGVPAVTNVGRRGGSGLAAGLTNELVHVASDVRDGDVSLTES	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	237 (194)
Sequences:	1630 (914)
Seq/√Len:	65.6

HALSA - Q9HPM1
SULSO - Q97WC4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_T	37_D	4.312	1.00
80_G	171_V	3.581	1.00
70_R	204_V	3.232	1.00
95_T	115_G	3.176	1.00
158_A	161_D	3.103	1.00
53_R	69_L	3.077	1.00
42_L	206_R	3.074	1.00
119_E	123_E	2.642	1.00
76_P	171_V	2.488	1.00
82_R	86_D	2.418	1.00
174_A	189_L	2.396	1.00
40_R	54_Q	2.344	1.00
187_T	204_V	2.230	1.00
120_L	131_A	2.120	1.00
95_T	98_K	2.009	1.00
56_S	212_L	1.998	1.00
40_R	50_D	1.981	1.00
187_T	191_E	1.962	1.00
64_E	207_R	1.948	1.00
157_L	181_K	1.940	1.00
114_I	129_T	1.913	1.00
76_P	80_G	1.887	1.00
84_V	106_H	1.875	1.00
175_T	216_L	1.872	1.00
56_S	216_L	1.864	1.00
61_G	206_R	1.825	1.00
30_D	33_E	1.798	1.00
49_A	71_F	1.792	1.00
160_A	189_L	1.785	1.00
148_V	213_A	1.779	1.00
163_I	198_V	1.772	1.00
135_E	138_K	1.771	1.00
120_L	124_T	1.760	1.00
164_A	196_Y	1.736	1.00
38_R	180_V	1.729	1.00
56_S	69_L	1.724	1.00
175_T	213_A	1.703	0.99
75_E	78_R	1.661	0.99
56_S	65_F	1.651	0.99
175_T	203_N	1.644	0.99
68_L	203_N	1.641	0.99
64_E	68_L	1.629	0.99
144_G	170_A	1.628	0.99
72_N	200_A	1.618	0.99
50_D	54_Q	1.553	0.99
190_R	204_V	1.550	0.99
89_P	111_R	1.536	0.99
146_I	171_V	1.512	0.99
133_V	149_V	1.481	0.98
172_A	189_L	1.475	0.98
147_A	159_L	1.443	0.98
83_A	171_V	1.433	0.98
60_T	212_L	1.425	0.98
94_I	97_V	1.393	0.98
124_T	131_A	1.384	0.98
48_L	53_R	1.363	0.97
126_M	131_A	1.346	0.97
64_E	67_H	1.342	0.97
98_K	110_V	1.320	0.97
188_R	191_E	1.314	0.97
70_R	190_R	1.292	0.96
42_L	63_P	1.280	0.96
142_Y	147_A	1.265	0.96
56_S	215_G	1.259	0.96
76_P	201_V	1.259	0.96
157_L	188_R	1.256	0.96
175_T	212_L	1.253	0.96
135_E	158_A	1.250	0.96
190_R	200_A	1.232	0.95
38_R	41_E	1.202	0.95
127_T	154_T	1.196	0.94
34_T	41_E	1.190	0.94
78_R	82_R	1.146	0.93
69_L	203_N	1.144	0.93
97_V	148_V	1.144	0.93
172_A	198_V	1.142	0.93
113_A	141_V	1.142	0.93
126_M	130_A	1.139	0.93
101_V	218_N	1.112	0.92
81_A	85_L	1.111	0.92
90_I	217_T	1.092	0.91
65_F	207_R	1.091	0.91
95_T	99_A	1.085	0.91
119_E	122_A	1.074	0.90
81_A	223_V	1.070	0.90
100_G	214_A	1.069	0.90
43_V	66_Q	1.054	0.90
101_V	110_V	1.052	0.90
187_T	190_R	1.043	0.89
101_V	217_T	1.038	0.89
133_V	162_C	1.036	0.89
70_R	200_A	1.032	0.89
114_I	132_S	1.022	0.88
48_L	66_Q	1.017	0.88
120_L	135_E	1.008	0.87
91_V	147_A	0.991	0.87
171_V	201_V	0.987	0.86
190_R	202_T	0.984	0.86
62_D	207_R	0.980	0.86
72_N	75_E	0.977	0.86
92_T	97_V	0.971	0.85
91_V	141_V	0.962	0.85
158_A	162_C	0.957	0.85
28_A	32_A	0.934	0.83
25_T	30_D	0.934	0.83
80_G	220_L	0.931	0.83
79_A	82_R	0.926	0.83
97_V	218_N	0.922	0.82
52_L	201_V	0.919	0.82
160_A	196_Y	0.917	0.82
120_L	123_E	0.915	0.82
55_K	215_G	0.914	0.82
163_I	196_Y	0.905	0.81
81_A	171_V	0.900	0.81
65_F	212_L	0.898	0.81
212_L	216_L	0.887	0.80
182_A	202_T	0.887	0.80
47_T	67_H	0.886	0.80
49_A	77_V	0.881	0.79
68_L	207_R	0.877	0.79
88_A	145_A	0.876	0.79
48_L	69_L	0.865	0.78
129_T	132_S	0.860	0.78
89_P	109_E	0.852	0.77
88_A	144_G	0.850	0.77
164_A	188_R	0.849	0.77
28_A	222_H	0.845	0.76
115_G	118_A	0.844	0.76
59_A	215_G	0.842	0.76
26_E	60_T	0.841	0.76
44_P	47_T	0.840	0.76
160_A	188_R	0.836	0.76
101_V	148_V	0.836	0.76
76_P	220_L	0.833	0.75
28_A	102_T	0.823	0.75
173_V	217_T	0.820	0.74
83_A	146_I	0.810	0.73
189_L	202_T	0.805	0.73
104_R	212_L	0.805	0.73
58_H	177_V	0.793	0.72
142_Y	145_A	0.793	0.72
214_A	218_N	0.789	0.71
53_R	71_F	0.786	0.71
96_M	100_G	0.782	0.71
97_V	214_A	0.775	0.70
72_N	199_P	0.774	0.70
149_V	202_T	0.772	0.70
137_D	162_C	0.771	0.70
96_M	151_N	0.767	0.69
42_L	61_G	0.766	0.69
163_I	166_G	0.758	0.68
89_P	143_D	0.755	0.68
62_D	212_L	0.753	0.68
213_A	217_T	0.752	0.68
43_V	50_D	0.747	0.67
49_A	76_P	0.741	0.67
158_A	165_D	0.740	0.66
95_T	114_I	0.739	0.66
80_G	146_I	0.736	0.66
161_D	166_G	0.735	0.66
203_N	212_L	0.732	0.66
56_S	175_T	0.732	0.66
30_D	34_T	0.730	0.65
120_L	138_K	0.730	0.65
130_A	157_L	0.728	0.65
52_L	219_E	0.727	0.65
71_F	201_V	0.727	0.65
177_V	180_V	0.725	0.65
120_L	126_M	0.724	0.65
142_Y	170_A	0.717	0.64
118_A	122_A	0.713	0.64
83_A	88_A	0.712	0.63
60_T	65_F	0.710	0.63
65_F	69_L	0.709	0.63
63_P	207_R	0.707	0.63
95_T	112_K	0.704	0.63
41_E	44_P	0.704	0.63
188_R	196_Y	0.703	0.62
210_S	214_A	0.700	0.62
97_V	211_G	0.700	0.62
145_A	170_A	0.698	0.62
34_T	38_R	0.696	0.62
52_L	216_L	0.693	0.61
149_V	159_L	0.690	0.61
58_H	154_T	0.686	0.61
73_G	76_P	0.686	0.61
60_T	175_T	0.685	0.60
75_E	199_P	0.676	0.59
153_P	177_V	0.676	0.59
178_G	186_R	0.673	0.59
36_M	210_S	0.668	0.59
84_V	146_I	0.666	0.58
151_N	210_S	0.664	0.58
160_A	182_A	0.661	0.58
80_G	83_A	0.658	0.57
59_A	94_I	0.658	0.57
65_F	94_I	0.653	0.57
171_V	220_L	0.652	0.57
212_L	215_G	0.651	0.57
168_R	197_G	0.650	0.56
173_V	216_L	0.650	0.56
65_F	203_N	0.649	0.56
72_N	76_P	0.647	0.56
129_T	157_L	0.644	0.56
109_E	141_V	0.644	0.56
159_L	163_I	0.643	0.56
127_T	151_N	0.629	0.54
211_G	214_A	0.629	0.54
89_P	108_C	0.629	0.54
160_A	164_A	0.629	0.54
60_T	216_L	0.627	0.54
42_L	57_V	0.622	0.53
57_V	63_P	0.622	0.53
89_P	145_A	0.620	0.53
29_L	33_E	0.620	0.53
48_L	71_F	0.620	0.53
128_R	152_A	0.612	0.52
166_G	197_G	0.611	0.52
61_G	137_D	0.611	0.52
62_D	213_A	0.606	0.51
128_R	205_G	0.605	0.51
148_V	217_T	0.603	0.51
90_I	221_V	0.598	0.50
65_F	68_L	0.598	0.50
144_G	147_A	0.590	0.49
44_P	67_H	0.589	0.49
37_D	41_E	0.589	0.49
117_G	132_S	0.585	0.49
53_R	66_Q	0.585	0.49
32_A	36_M	0.582	0.49
63_P	66_Q	0.581	0.48
162_C	167_T	0.575	0.48
121_A	131_A	0.574	0.48
79_A	125_G	0.571	0.47
84_V	220_L	0.569	0.47
73_G	82_R	0.568	0.47
27_K	30_D	0.568	0.47
62_D	129_T	0.567	0.47
56_S	71_F	0.564	0.46
82_R	139_Q	0.563	0.46
92_T	210_S	0.560	0.46
31_I	154_T	0.560	0.46
82_R	85_L	0.560	0.46
73_G	141_V	0.560	0.46
77_V	81_A	0.560	0.46
33_E	37_D	0.559	0.46
35_S	96_M	0.559	0.46
59_A	214_A	0.556	0.45
117_G	131_A	0.556	0.45
100_G	210_S	0.553	0.45
117_G	128_R	0.552	0.45
58_H	219_E	0.551	0.45
63_P	206_R	0.551	0.45
159_L	167_T	0.551	0.45
24_T	157_L	0.550	0.45
187_T	202_T	0.549	0.45
153_P	209_G	0.545	0.44
151_N	177_V	0.544	0.44
120_L	136_L	0.543	0.44
129_T	181_K	0.540	0.44
157_L	160_A	0.538	0.43
113_A	132_S	0.536	0.43
99_A	112_K	0.535	0.43
147_A	197_G	0.531	0.43
51_R	81_A	0.530	0.42
75_E	79_A	0.529	0.42
91_V	222_H	0.527	0.42
36_M	206_R	0.527	0.42
165_D	215_G	0.527	0.42
35_S	177_V	0.523	0.42
52_L	71_F	0.522	0.42
58_H	180_V	0.522	0.42
24_T	181_K	0.520	0.41
27_K	129_T	0.520	0.41
49_A	75_E	0.517	0.41
79_A	89_P	0.517	0.41
135_E	162_C	0.515	0.41
159_L	169_P	0.515	0.41
144_G	169_P	0.512	0.40
100_G	151_N	0.511	0.40
145_A	182_A	0.509	0.40
117_G	135_E	0.509	0.40
156_A	189_L	0.508	0.40
43_V	57_V	0.508	0.40
71_F	76_P	0.505	0.40
97_V	217_T	0.504	0.40
151_N	180_V	0.503	0.39
184_E	210_S	0.502	0.39
24_T	161_D	0.501	0.39
35_S	153_P	0.501	0.39
111_R	141_V	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2afrA	2	0.865	100	0.181	Contact Map
1v9cA	2	0.8354	100	0.186	Contact Map
4au1A	2	0.8354	100	0.189	Contact Map
1f2vA	2	0.8481	100	0.196	Contact Map
3e7dA	2	0.827	100	0.198	Contact Map
1ou0A	4	0.7848	100	0.209	Contact Map
2fiqA	4	0.443	24.8	0.963	Contact Map
1snnA	2	0.5612	24.3	0.963	Contact Map
1tksA	2	0.5781	19.7	0.965	Contact Map
4i14A	2	0.692	18.4	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.