Q9HPL6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPL6 - Cobalamin adenosyltransferase

UniProt:	Q9HPL6	Sequences: MTATDDDTTTADEQDADTMRPAEITPTAPAEFGLVQVWWGDGKGKTTAALGMAMRAAGHGFRTHVVQLMKGGTGTVEDVRGEYAAIDAVPGITYENAGHYGWHGFHDGSSDDEHAARANGGLARAQEIVDASTGVDGAVPLDADPTEGVHLLVLDEVLYAANRGLVDPEDVVALIDTKPDDLEVVLTGGHTEPTFVTERADLVTEVRKQRHPMENGQGARKGTEY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	225 (177)
Sequences:	1885 (985)
Seq/√Len:	74.0

ECOLI - BTUR
HALSA - Q9HPL6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
157_V	186_L	3.947	1.00
208_K	214_E	3.548	1.00
194_T	198_E	3.258	1.00
53_A	153_V	2.996	1.00
202_L	212_P	2.953	1.00
176_D	199_R	2.874	1.00
64_H	128_I	2.784	1.00
119_N	170_D	2.592	1.00
46_T	50_L	2.498	1.00
175_I	184_V	2.491	1.00
49_A	153_V	2.393	1.00
183_E	220_R	2.294	1.00
126_Q	170_D	2.200	1.00
52_M	185_V	2.197	1.00
168_P	195_F	2.158	1.00
54_M	85_A	2.106	1.00
37_V	196_V	2.083	1.00
95_E	124_R	2.081	1.00
173_A	177_T	1.978	1.00
39_W	192_E	1.974	1.00
35_V	186_L	1.943	1.00
157_V	171_V	1.910	1.00
50_L	54_M	1.905	1.00
59_H	81_G	1.881	1.00
34_L	212_P	1.879	1.00
168_P	193_P	1.833	1.00
124_R	127_E	1.823	1.00
35_V	178_K	1.780	1.00
56_A	61_F	1.761	1.00
205_E	209_Q	1.700	1.00
168_P	172_V	1.665	1.00
93_T	149_V	1.632	1.00
161_A	193_P	1.628	1.00
36_Q	202_L	1.615	0.99
36_Q	183_E	1.614	0.99
53_A	65_V	1.606	0.99
57_A	92_I	1.604	0.99
35_V	175_I	1.600	0.99
38_W	48_A	1.584	0.99
197_T	203_V	1.574	0.99
86_I	92_I	1.568	0.99
53_A	63_T	1.516	0.99
54_M	86_I	1.500	0.99
112_D	116_A	1.492	0.99
174_L	184_V	1.470	0.99
41_D	208_K	1.456	0.99
65_V	153_V	1.454	0.99
83_Y	87_D	1.453	0.99
169_E	195_F	1.417	0.99
65_V	92_I	1.412	0.99
152_L	182_L	1.395	0.98
119_N	123_A	1.380	0.98
172_V	199_R	1.378	0.98
93_T	128_I	1.341	0.98
116_A	120_G	1.322	0.98
50_L	65_V	1.309	0.98
203_V	210_R	1.308	0.98
158_L	192_E	1.294	0.98
53_A	92_I	1.282	0.97
129_V	174_L	1.274	0.97
49_A	187_T	1.274	0.97
34_L	217_Q	1.264	0.97
36_Q	220_R	1.212	0.96
161_A	166_V	1.207	0.96
99_H	113_E	1.196	0.96
162_N	190_H	1.191	0.96
172_V	176_D	1.188	0.96
125_A	154_L	1.169	0.95
36_Q	212_P	1.161	0.95
64_H	149_V	1.157	0.95
123_A	126_Q	1.120	0.94
62_R	148_G	1.118	0.94
129_V	182_L	1.113	0.94
57_A	85_A	1.105	0.94
126_Q	174_L	1.100	0.94
61_F	150_H	1.082	0.93
97_A	121_G	1.080	0.93
88_A	91_G	1.069	0.93
146_T	149_V	1.066	0.93
128_I	149_V	1.048	0.92
192_E	196_V	1.038	0.92
39_W	189_G	1.029	0.91
101_G	110_S	1.026	0.91
56_A	150_H	1.024	0.91
192_E	197_T	1.023	0.91
149_V	152_L	1.005	0.90
85_A	89_V	1.000	0.90
120_G	123_A	0.998	0.90
66_V	125_A	0.992	0.90
161_A	171_V	0.990	0.90
47_T	67_Q	0.985	0.89
68_L	125_A	0.984	0.89
167_D	170_D	0.965	0.88
161_A	168_P	0.964	0.88
69_M	159_Y	0.960	0.88
123_A	127_E	0.959	0.88
201_D	215_N	0.956	0.88
212_P	217_Q	0.947	0.87
101_G	104_G	0.944	0.87
115_A	119_N	0.939	0.87
179_P	182_L	0.932	0.87
178_K	184_V	0.931	0.87
103_H	165_L	0.930	0.87
119_N	167_D	0.922	0.86
52_M	224_E	0.920	0.86
66_V	124_R	0.915	0.86
151_L	185_V	0.905	0.85
38_W	206_V	0.903	0.85
47_T	52_M	0.900	0.85
38_W	47_T	0.896	0.84
150_H	181_D	0.891	0.84
197_T	209_Q	0.885	0.84
41_D	207_R	0.882	0.83
66_V	97_A	0.880	0.83
178_K	182_L	0.880	0.83
33_G	178_K	0.879	0.83
98_G	121_G	0.863	0.82
110_S	113_E	0.863	0.82
169_E	173_A	0.861	0.82
64_H	95_E	0.858	0.82
38_W	52_M	0.848	0.81
35_V	199_R	0.847	0.81
93_T	127_E	0.836	0.80
147_E	182_L	0.828	0.79
126_Q	173_A	0.823	0.79
31_E	218_G	0.821	0.79
173_A	176_D	0.810	0.78
110_S	114_H	0.805	0.77
164_G	193_P	0.803	0.77
66_V	95_E	0.802	0.77
35_V	157_V	0.797	0.77
98_G	118_A	0.792	0.76
66_V	121_G	0.782	0.75
166_V	171_V	0.775	0.75
84_A	87_D	0.774	0.75
37_V	158_L	0.766	0.74
59_H	224_E	0.766	0.74
74_G	84_A	0.749	0.72
114_H	118_A	0.748	0.72
129_V	184_V	0.748	0.72
25_T	28_A	0.746	0.72
57_A	89_V	0.746	0.72
99_H	114_H	0.745	0.72
99_H	117_R	0.744	0.72
147_E	181_D	0.743	0.72
126_Q	177_T	0.739	0.71
41_D	190_H	0.739	0.71
26_P	29_P	0.736	0.71
52_M	223_T	0.734	0.71
159_Y	163_R	0.734	0.71
69_M	117_R	0.728	0.70
183_E	202_L	0.716	0.69
52_M	151_L	0.711	0.68
108_G	111_D	0.709	0.68
41_D	194_T	0.703	0.67
126_Q	130_D	0.703	0.67
62_R	150_H	0.702	0.67
81_G	85_A	0.687	0.66
38_W	212_P	0.686	0.65
160_A	166_V	0.685	0.65
62_R	91_G	0.684	0.65
97_A	124_R	0.682	0.65
69_M	103_H	0.678	0.65
130_D	177_T	0.676	0.64
83_Y	94_Y	0.674	0.64
71_G	96_N	0.673	0.64
122_L	129_V	0.669	0.64
85_A	88_A	0.668	0.63
114_H	117_R	0.667	0.63
200_A	203_V	0.666	0.63
129_V	152_L	0.665	0.63
89_V	92_I	0.653	0.62
83_Y	96_N	0.652	0.62
103_H	111_D	0.652	0.62
69_M	101_G	0.651	0.61
113_E	165_L	0.644	0.61
38_W	220_R	0.644	0.61
125_A	128_I	0.641	0.60
32_F	217_Q	0.641	0.60
38_W	202_L	0.634	0.59
59_H	221_K	0.632	0.59
38_W	208_K	0.631	0.59
124_R	128_I	0.630	0.59
104_G	122_L	0.626	0.58
27_T	30_A	0.626	0.58
110_S	118_A	0.623	0.58
197_T	210_R	0.622	0.58
122_L	126_Q	0.618	0.57
158_L	224_E	0.618	0.57
56_A	151_L	0.616	0.57
50_L	83_Y	0.616	0.57
62_R	93_T	0.615	0.57
183_E	224_E	0.615	0.57
107_D	117_R	0.611	0.57
61_F	221_K	0.610	0.56
65_V	94_Y	0.605	0.56
98_G	114_H	0.602	0.56
159_Y	162_N	0.595	0.55
177_T	215_N	0.595	0.55
103_H	108_G	0.592	0.54
48_A	52_M	0.591	0.54
118_A	121_G	0.589	0.54
104_G	108_G	0.589	0.54
83_Y	224_E	0.588	0.54
104_G	110_S	0.587	0.54
170_D	174_L	0.587	0.54
111_D	115_A	0.586	0.54
114_H	159_Y	0.586	0.54
97_A	117_R	0.582	0.53
115_A	165_L	0.580	0.53
61_F	183_E	0.574	0.52
122_L	165_L	0.573	0.52
121_G	125_A	0.567	0.51
127_E	146_T	0.564	0.51
125_A	152_L	0.563	0.51
104_G	165_L	0.561	0.50
48_A	206_V	0.560	0.50
122_L	174_L	0.558	0.50
149_V	182_L	0.556	0.50
51_G	82_E	0.555	0.50
174_L	178_K	0.555	0.50
152_L	215_N	0.554	0.50
130_D	146_T	0.552	0.49
71_G	83_Y	0.551	0.49
94_Y	221_K	0.549	0.49
146_T	152_L	0.544	0.48
71_G	114_H	0.543	0.48
185_V	223_T	0.542	0.48
221_K	225_Y	0.538	0.48
53_A	151_L	0.538	0.48
39_W	203_V	0.536	0.47
34_L	202_L	0.536	0.47
208_K	224_E	0.534	0.47
83_Y	190_H	0.534	0.47
101_G	114_H	0.533	0.47
46_T	83_Y	0.531	0.47
65_V	86_I	0.531	0.47
203_V	209_Q	0.530	0.47
72_G	80_R	0.530	0.47
113_E	116_A	0.529	0.46
42_G	45_K	0.528	0.46
40_G	51_G	0.524	0.46
186_L	196_V	0.523	0.46
123_A	169_E	0.523	0.46
168_P	197_T	0.522	0.46
38_W	183_E	0.520	0.45
169_E	176_D	0.520	0.45
55_R	204_T	0.518	0.45
157_V	161_A	0.518	0.45
73_T	84_A	0.518	0.45
48_A	204_T	0.517	0.45
212_P	220_R	0.517	0.45
62_R	149_V	0.513	0.44
102_W	111_D	0.511	0.44
123_A	130_D	0.511	0.44
127_E	130_D	0.509	0.44
50_L	94_Y	0.509	0.44
74_G	80_R	0.509	0.44
55_R	58_G	0.506	0.44
81_G	84_A	0.506	0.44
36_Q	223_T	0.504	0.43
164_G	167_D	0.504	0.43
108_G	115_A	0.504	0.43
73_T	87_D	0.502	0.43
61_F	181_D	0.501	0.43
69_M	165_L	0.500	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1g5tA	2	0.6978	100	0.479	Contact Map
2orvA	3	0.5689	100	0.654	Contact Map
2j9rA	3	0.6	99.8	0.747	Contact Map
1w4rA	3	0.6222	99.7	0.765	Contact Map
3e2iA	3	0.5911	99.7	0.775	Contact Map
1xx6A	4	0.6267	99.6	0.779	Contact Map
2b8tA	3	0.6533	99.4	0.808	Contact Map
4uxhA	3	0.6089	98.8	0.853	Contact Map
2orwA	3	0.6089	98.7	0.86	Contact Map
4a4zA	1	0.8667	96.6	0.909	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.