Q9HPL1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPL1 - Uncharacterized protein

UniProt:	Q9HPL1	Sequences: MMCGGRGTRLDAAAEKPLFEVGGRAMVDHVRAALEAAGRIDTTHAAVSPHAPDTAAHLAATPLSLIETPGDGYVADLTAALDAVGTPVLTVAADLPLLAPAVVDTVVAAADGATTSACVPRALKHELGVSTDADADAWVPTGVNVVGGGDTEATHRSFDARLAVNVNHRSDAAVAARLLAATDRRNHPR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	189 (176)
Sequences:	180 (144)
Seq/√Len:	10.8

HALSA - Q9HPL1
SULSO - Q7LY05

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
46_A	68_T	4.932	1.00
69_P	79_A	4.028	0.99
3_C	45_A	3.329	0.97
5_G	9_R	3.165	0.96
4_G	9_R	3.165	0.96
140_P	144_N	3.159	0.96
55_A	67_E	3.032	0.94
72_G	75_A	2.629	0.89
28_D	57_H	2.487	0.86
77_L	81_L	2.361	0.83
17_P	93_A	2.235	0.79
69_P	143_V	2.176	0.77
2_M	5_G	2.102	0.74
3_C	9_R	2.087	0.74
19_F	92_A	2.041	0.72
15_E	54_T	1.976	0.70
15_E	52_P	1.832	0.63
91_V	98_L	1.794	0.62
4_G	7_G	1.752	0.60
12_A	47_V	1.742	0.59
66_I	131_T	1.721	0.58
40_I	169_R	1.706	0.58
2_M	9_R	1.705	0.58
10_L	140_P	1.673	0.56
62_P	109_A	1.658	0.55
34_L	43_T	1.649	0.55
89_L	102_V	1.646	0.55
19_F	172_A	1.610	0.53
25_A	96_P	1.575	0.51
114_T	117_A	1.511	0.48
92_A	95_L	1.506	0.48
29_H	103_V	1.490	0.47
20_E	44_H	1.459	0.46
63_L	143_V	1.459	0.46
3_C	103_V	1.436	0.45
27_V	145_V	1.433	0.45
5_G	16_K	1.411	0.44
4_G	16_K	1.411	0.44
7_G	17_P	1.407	0.43
66_I	95_L	1.398	0.43
44_H	47_V	1.374	0.42
27_V	166_V	1.352	0.41
31_R	85_G	1.334	0.40
22_G	156_R	1.321	0.39
24_R	179_L	1.303	0.39
30_V	167_N	1.290	0.38
44_H	68_T	1.282	0.38
12_A	19_F	1.280	0.38
101_A	137_A	1.272	0.37
92_A	144_N	1.270	0.37
144_N	150_D	1.263	0.37
51_A	93_A	1.254	0.36
11_D	172_A	1.253	0.36
114_T	150_D	1.233	0.36
80_A	84_V	1.222	0.35
7_G	171_D	1.220	0.35
33_A	148_G	1.219	0.35
46_A	91_V	1.215	0.35
31_R	166_V	1.212	0.35
26_M	96_P	1.209	0.35
109_A	126_E	1.197	0.34
84_V	88_V	1.197	0.34
31_R	63_L	1.186	0.34
50_H	81_L	1.185	0.33
129_V	168_H	1.185	0.33
10_L	28_D	1.165	0.33
31_R	89_L	1.161	0.32
2_M	7_G	1.159	0.32
31_R	146_V	1.157	0.32
9_R	16_K	1.151	0.32
89_L	103_V	1.136	0.31
43_T	169_R	1.132	0.31
63_L	164_V	1.109	0.30
27_V	131_T	1.091	0.30
97_L	128_G	1.084	0.29
54_T	152_E	1.083	0.29
77_L	175_A	1.076	0.29
21_V	26_M	1.067	0.29
10_L	50_H	1.065	0.29
146_V	161_R	1.057	0.28
87_P	129_V	1.048	0.28
100_P	171_D	1.046	0.28
95_L	140_P	1.015	0.27
106_V	151_T	0.997	0.26
138_W	152_E	0.996	0.26
120_P	144_N	0.995	0.26
48_S	54_T	0.974	0.25
106_V	176_A	0.973	0.25
22_G	179_L	0.972	0.25
15_E	48_S	0.964	0.25
74_V	140_P	0.958	0.25
43_T	66_I	0.958	0.25
2_M	6_R	0.957	0.25
99_A	103_V	0.957	0.25
73_Y	120_P	0.956	0.25
89_L	169_R	0.955	0.25
7_G	141_T	0.952	0.24
30_V	162_L	0.952	0.24
31_R	122_A	0.950	0.24
90_T	130_S	0.946	0.24
137_A	149_G	0.934	0.24
43_T	156_R	0.929	0.24
98_L	103_V	0.920	0.23
92_A	146_V	0.920	0.23
143_V	151_T	0.914	0.23
65_L	138_W	0.913	0.23
72_G	121_R	0.906	0.23
93_A	120_P	0.905	0.23
68_T	167_N	0.904	0.23
34_L	58_L	0.901	0.23
48_S	66_I	0.897	0.23
72_G	91_V	0.894	0.22
48_S	163_A	0.890	0.22
70_G	76_D	0.877	0.22
70_G	94_D	0.877	0.22
76_D	94_D	0.877	0.22
54_T	144_N	0.875	0.22
22_G	103_V	0.875	0.22
46_A	84_V	0.874	0.22
34_L	97_L	0.873	0.22
15_E	51_A	0.872	0.22
7_G	10_L	0.870	0.22
48_S	77_L	0.869	0.22
5_G	10_L	0.858	0.21
4_G	10_L	0.858	0.21
110_A	179_L	0.856	0.21
75_A	133_A	0.849	0.21
80_A	135_A	0.848	0.21
67_E	111_D	0.842	0.21
99_A	115_T	0.840	0.21
160_A	166_V	0.840	0.21
33_A	96_P	0.836	0.21
89_L	107_V	0.830	0.20
118_C	138_W	0.829	0.20
143_V	157_S	0.823	0.20
74_V	144_N	0.819	0.20
145_V	166_V	0.811	0.20
117_A	164_V	0.806	0.20
110_A	144_N	0.804	0.20
46_A	167_N	0.804	0.20
51_A	114_T	0.803	0.20
23_G	166_V	0.802	0.20
81_L	156_R	0.799	0.19
99_A	102_V	0.790	0.19
101_A	152_E	0.786	0.19
49_P	88_V	0.785	0.19
146_V	150_D	0.779	0.19
27_V	179_L	0.776	0.19
118_C	168_H	0.776	0.19
33_A	98_L	0.769	0.19
26_M	166_V	0.765	0.18
6_R	64_S	0.765	0.18
6_R	59_A	0.762	0.18
24_R	101_A	0.761	0.18
120_P	162_L	0.757	0.18
27_V	45_A	0.754	0.18
129_V	174_V	0.754	0.18
34_L	95_L	0.752	0.18
66_I	107_V	0.751	0.18
38_G	98_L	0.746	0.18
36_A	104_D	0.744	0.18
69_P	132_D	0.742	0.18
45_A	88_V	0.740	0.18
30_V	96_P	0.739	0.18
48_S	162_L	0.735	0.18
78_T	81_L	0.733	0.18
74_V	120_P	0.726	0.17
10_L	84_V	0.724	0.17
21_V	175_A	0.723	0.17
28_D	38_G	0.723	0.17
112_G	158_F	0.717	0.17
21_V	25_A	0.713	0.17
87_P	171_D	0.701	0.17
93_A	131_T	0.699	0.17
40_I	120_P	0.698	0.17
47_V	136_D	0.695	0.16
81_L	99_A	0.695	0.16
63_L	135_A	0.693	0.16
3_C	58_L	0.691	0.16
53_D	178_L	0.691	0.16
48_S	58_L	0.690	0.16
21_V	164_V	0.683	0.16
43_T	177_R	0.683	0.16
14_A	80_A	0.682	0.16
53_D	60_A	0.680	0.16
140_P	145_V	0.679	0.16
39_R	47_V	0.677	0.16
34_L	128_G	0.677	0.16
96_P	159_D	0.671	0.16
147_G	173_A	0.660	0.16
84_V	148_G	0.660	0.16
97_L	159_D	0.659	0.16
10_L	87_P	0.658	0.16
31_R	173_A	0.657	0.16
3_C	10_L	0.655	0.15
49_P	97_L	0.655	0.15
93_A	127_L	0.655	0.15
149_G	160_A	0.646	0.15
14_A	51_A	0.644	0.15
125_H	164_V	0.643	0.15
73_Y	87_P	0.642	0.15
59_A	82_D	0.638	0.15
23_G	145_V	0.632	0.15
46_A	80_A	0.629	0.15
127_L	132_D	0.625	0.15
94_D	142_G	0.624	0.15
76_D	142_G	0.624	0.15
70_G	142_G	0.624	0.15
38_G	168_H	0.624	0.15
12_A	21_V	0.618	0.15
97_L	117_A	0.618	0.15
20_E	169_R	0.617	0.15
45_A	155_H	0.616	0.15
95_L	144_N	0.601	0.14
43_T	99_A	0.598	0.14
19_F	138_W	0.594	0.14
35_E	106_V	0.591	0.14
6_R	12_A	0.590	0.14
29_H	110_A	0.585	0.14
164_V	174_V	0.579	0.14
143_V	154_T	0.579	0.14
130_S	175_A	0.578	0.14
82_D	177_R	0.572	0.14
150_D	155_H	0.572	0.14
152_E	178_L	0.567	0.13
62_P	132_D	0.565	0.13
66_I	71_D	0.564	0.13
113_A	151_T	0.562	0.13
40_I	47_V	0.560	0.13
38_G	87_P	0.558	0.13
62_P	71_D	0.557	0.13
124_K	166_V	0.555	0.13
24_R	64_S	0.553	0.13
24_R	39_R	0.553	0.13
14_A	19_F	0.550	0.13
31_R	36_A	0.546	0.13
21_V	50_H	0.544	0.13
21_V	85_G	0.542	0.13
77_L	90_T	0.541	0.13
62_P	67_E	0.539	0.13
65_L	107_V	0.534	0.13
73_Y	77_L	0.532	0.13
54_T	162_L	0.528	0.13
53_D	56_A	0.527	0.13
2_M	16_K	0.526	0.13
18_L	72_G	0.526	0.13
55_A	59_A	0.525	0.12
77_L	92_A	0.522	0.12
93_A	100_P	0.521	0.12
19_F	174_V	0.519	0.12
55_A	80_A	0.517	0.12
90_T	154_T	0.515	0.12
84_V	155_H	0.511	0.12
27_V	58_L	0.509	0.12
89_L	98_L	0.509	0.12
60_A	85_G	0.507	0.12
16_K	70_G	0.506	0.12
16_K	76_D	0.506	0.12
16_K	94_D	0.506	0.12
2_M	95_L	0.503	0.12
108_A	115_T	0.502	0.12
22_G	29_H	0.501	0.12
17_P	140_P	0.500	0.12
60_A	69_P	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rsbA	1	0.873	99.9	0.627	Contact Map
1vpaA	2	0.9577	99.9	0.674	Contact Map
2weeA	1	0.9153	99.9	0.679	Contact Map
2wawA	1	0.9365	99.9	0.679	Contact Map
3ngwA	2	0.8942	99.9	0.687	Contact Map
3q80A	2	0.9418	99.9	0.688	Contact Map
1i52A	2	0.9471	99.9	0.69	Contact Map
4fceA	3	0.9683	99.9	0.692	Contact Map
4zdqA	2	0.9524	99.9	0.692	Contact Map
2xwlA	2	0.963	99.9	0.694	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.