Q9HPJ6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPJ6 - Chemotaxis protein

UniProt:	Q9HPJ6	Sequences: MSATIELRAFRDINELADASAATVRGHIEQLAGVEAAVSVTGLTFLAPEDLGQHLGTAQTYAASVPLESRPHGVFCLNLGDTGGAALAEQMTGTEIAGTLSNMQESALKELMNILASGFLDGIANSLGIEIIHGPPTVYHDSGPVIADTLRPSGTEQPLLIMVNLGVELPALTETPVTFYLIPSADEFASLLNDLS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	196 (190)
Sequences:	1124 (856)
Seq/√Len:	62.1

BACSU - CHEC FLIY
HALSA - Q9HPJ6 F2Z5Y8 Q9HQW8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
141_D	145_V	4.130	1.00
101_S	104_Q	3.547	1.00
15_E	18_D	3.412	1.00
15_E	19_A	3.221	1.00
18_D	41_T	3.055	1.00
15_E	22_A	2.871	1.00
15_E	41_T	2.812	1.00
66_P	134_G	2.771	1.00
60_T	78_N	2.675	1.00
6_E	9_A	2.638	1.00
117_S	121_D	2.527	1.00
64_S	74_V	2.429	1.00
71_P	191_L	2.320	1.00
120_L	123_I	2.254	1.00
18_D	22_A	2.243	1.00
42_G	164_N	2.213	1.00
85_A	100_L	2.089	1.00
73_G	163_V	2.036	1.00
63_A	112_M	2.010	1.00
25_R	188_F	1.961	1.00
111_L	161_I	1.952	1.00
11_R	15_E	1.912	1.00
76_C	150_L	1.910	1.00
19_A	22_A	1.907	1.00
11_R	19_A	1.901	1.00
5_I	9_A	1.874	1.00
11_R	22_A	1.824	1.00
26_G	30_Q	1.813	1.00
91_M	111_L	1.771	1.00
39_S	166_G	1.762	0.99
121_D	125_N	1.759	0.99
82_T	186_D	1.731	0.99
120_L	133_H	1.713	0.99
75_F	116_A	1.706	0.99
62_A	146_I	1.646	0.99
60_T	143_G	1.636	0.99
19_A	41_T	1.623	0.99
67_L	73_G	1.545	0.99
56_G	144_P	1.539	0.99
135_P	165_L	1.535	0.99
38_V	41_T	1.524	0.98
22_A	41_T	1.519	0.98
190_S	193_N	1.444	0.98
17_A	163_V	1.425	0.98
63_A	108_L	1.424	0.98
159_L	191_L	1.422	0.98
118_G	188_F	1.373	0.97
21_A	38_V	1.333	0.96
118_G	138_V	1.325	0.96
46_L	50_D	1.301	0.96
70_R	129_I	1.291	0.96
8_R	55_L	1.291	0.96
59_Q	139_Y	1.290	0.96
16_L	187_E	1.263	0.95
77_L	177_V	1.251	0.95
34_V	90_Q	1.249	0.95
31_L	114_I	1.245	0.95
106_S	183_P	1.229	0.94
142_S	145_V	1.203	0.94
161_I	167_V	1.202	0.94
20_S	122_G	1.188	0.93
115_L	191_L	1.179	0.93
36_A	122_G	1.170	0.93
110_E	114_I	1.145	0.92
36_A	43_L	1.140	0.92
61_Y	108_L	1.131	0.91
19_A	69_S	1.127	0.91
51_L	108_L	1.115	0.91
167_V	182_I	1.111	0.91
16_L	179_F	1.109	0.91
119_F	134_G	1.105	0.90
21_A	120_L	1.098	0.90
166_G	174_E	1.086	0.90
67_L	161_I	1.085	0.90
73_G	187_E	1.084	0.90
168_E	174_E	1.082	0.90
109_K	188_F	1.081	0.89
54_H	79_L	1.073	0.89
29_E	195_L	1.073	0.89
19_A	126_S	1.072	0.89
11_R	114_I	1.052	0.88
88_A	92_T	1.047	0.88
89_E	96_I	1.046	0.88
26_G	122_G	1.038	0.88
88_A	107_A	1.037	0.87
46_L	68_E	1.023	0.87
115_L	118_G	1.023	0.87
91_M	107_A	1.020	0.87
78_N	90_Q	1.016	0.86
79_L	120_L	1.012	0.86
86_A	96_I	1.011	0.86
86_A	175_T	1.000	0.85
6_E	88_A	0.996	0.85
43_L	144_P	0.994	0.85
51_L	90_Q	0.985	0.85
11_R	41_T	0.962	0.83
48_P	56_G	0.956	0.83
83_G	175_T	0.949	0.82
117_S	161_I	0.949	0.82
61_Y	88_A	0.948	0.82
151_R	182_I	0.942	0.82
40_V	129_I	0.941	0.82
28_I	111_L	0.935	0.81
88_A	104_Q	0.935	0.81
25_R	36_A	0.934	0.81
53_Q	57_T	0.927	0.81
11_R	18_D	0.920	0.80
133_H	165_L	0.920	0.80
85_A	89_E	0.915	0.80
45_F	144_P	0.915	0.80
94_T	132_I	0.907	0.79
84_G	141_D	0.897	0.79
179_F	183_P	0.892	0.78
67_L	179_F	0.887	0.78
35_E	164_N	0.885	0.78
87_L	111_L	0.883	0.78
119_F	177_V	0.880	0.77
84_G	160_L	0.880	0.77
96_I	195_L	0.871	0.77
88_A	162_M	0.868	0.76
109_K	138_V	0.867	0.76
25_R	41_T	0.867	0.76
113_N	135_P	0.862	0.76
45_F	162_M	0.862	0.76
146_I	164_N	0.859	0.76
153_S	157_Q	0.853	0.75
17_A	20_S	0.848	0.75
9_A	120_L	0.847	0.75
47_A	50_D	0.844	0.74
21_A	165_L	0.842	0.74
87_L	114_I	0.829	0.73
20_S	111_L	0.828	0.73
160_L	164_N	0.826	0.73
72_H	131_I	0.824	0.72
165_L	177_V	0.824	0.72
24_V	147_A	0.823	0.72
92_T	110_E	0.821	0.72
156_E	191_L	0.819	0.72
17_A	119_F	0.815	0.72
27_H	118_G	0.815	0.72
157_Q	160_L	0.814	0.72
67_L	181_L	0.810	0.71
60_T	91_M	0.807	0.71
20_S	183_P	0.804	0.71
20_S	24_V	0.800	0.70
31_L	179_F	0.800	0.70
110_E	177_V	0.800	0.70
24_V	135_P	0.786	0.69
73_G	131_I	0.786	0.69
161_I	188_F	0.770	0.67
106_S	119_F	0.768	0.67
60_T	124_A	0.767	0.67
51_L	55_L	0.767	0.67
52_G	160_L	0.763	0.67
87_L	178_T	0.763	0.67
138_V	186_D	0.762	0.66
31_L	84_G	0.760	0.66
29_E	92_T	0.750	0.65
89_E	97_A	0.745	0.65
169_L	175_T	0.740	0.64
100_L	104_Q	0.737	0.64
110_E	113_N	0.736	0.64
30_Q	193_N	0.734	0.64
117_S	127_L	0.734	0.64
11_R	14_N	0.734	0.64
62_A	123_I	0.734	0.64
106_S	165_L	0.732	0.63
13_I	123_I	0.727	0.63
103_M	106_S	0.727	0.63
129_I	180_Y	0.724	0.63
148_D	154_G	0.722	0.62
34_V	169_L	0.721	0.62
16_L	123_I	0.716	0.62
33_G	174_E	0.715	0.62
23_T	67_L	0.714	0.61
86_A	193_N	0.709	0.61
72_H	186_D	0.707	0.61
78_N	181_L	0.705	0.60
25_R	119_F	0.704	0.60
75_F	127_L	0.704	0.60
35_E	75_F	0.702	0.60
73_G	122_G	0.694	0.59
23_T	106_S	0.689	0.59
61_Y	84_G	0.688	0.59
108_L	163_V	0.687	0.58
90_Q	132_I	0.686	0.58
7_L	189_A	0.685	0.58
121_D	183_P	0.680	0.58
48_P	165_L	0.678	0.57
50_D	182_I	0.677	0.57
121_D	177_V	0.676	0.57
122_G	177_V	0.669	0.56
17_A	100_L	0.669	0.56
85_A	104_Q	0.668	0.56
20_S	143_G	0.666	0.56
130_E	195_L	0.666	0.56
30_Q	121_D	0.664	0.56
66_P	184_S	0.663	0.56
107_A	113_N	0.660	0.55
110_E	135_P	0.660	0.55
5_I	10_F	0.659	0.55
47_A	159_L	0.657	0.55
120_L	132_I	0.657	0.55
34_V	170_P	0.657	0.55
65_V	81_D	0.651	0.54
5_I	164_N	0.646	0.54
65_V	106_S	0.643	0.54
115_L	180_Y	0.640	0.53
77_L	184_S	0.638	0.53
110_E	165_L	0.637	0.53
33_G	47_A	0.636	0.53
112_M	117_S	0.632	0.52
59_Q	144_P	0.631	0.52
91_M	102_N	0.630	0.52
82_T	101_S	0.630	0.52
65_V	192_L	0.629	0.52
29_E	48_P	0.629	0.52
78_N	180_Y	0.626	0.52
84_G	175_T	0.624	0.51
37_A	192_L	0.622	0.51
76_C	186_D	0.619	0.51
72_H	184_S	0.617	0.51
44_T	82_T	0.614	0.50
85_A	99_T	0.612	0.50
75_F	96_I	0.611	0.50
25_R	38_V	0.608	0.50
44_T	164_N	0.605	0.49
33_G	137_T	0.603	0.49
49_E	124_A	0.603	0.49
93_G	101_S	0.603	0.49
102_N	106_S	0.600	0.49
79_L	177_V	0.599	0.48
12_D	88_A	0.597	0.48
21_A	25_R	0.597	0.48
64_S	160_L	0.597	0.48
160_L	169_L	0.596	0.48
12_D	148_D	0.595	0.48
54_H	86_A	0.595	0.48
95_E	176_P	0.593	0.48
98_G	193_N	0.592	0.48
141_D	195_L	0.590	0.47
79_L	157_Q	0.585	0.47
68_E	175_T	0.582	0.47
5_I	97_A	0.581	0.46
71_P	162_M	0.580	0.46
129_I	194_D	0.580	0.46
55_L	79_L	0.577	0.46
71_P	187_E	0.575	0.46
58_A	115_L	0.568	0.45
11_R	38_V	0.567	0.45
21_A	183_P	0.565	0.45
36_A	81_D	0.565	0.45
21_A	141_D	0.564	0.45
21_A	119_F	0.564	0.45
157_Q	163_V	0.560	0.44
22_A	63_A	0.559	0.44
21_A	167_V	0.557	0.44
55_L	171_A	0.556	0.44
19_A	23_T	0.555	0.44
106_S	135_P	0.554	0.43
85_A	102_N	0.550	0.43
57_T	144_P	0.548	0.43
57_T	178_T	0.546	0.42
15_E	25_R	0.544	0.42
134_G	139_Y	0.543	0.42
67_L	74_V	0.540	0.42
83_G	117_S	0.539	0.42
71_P	129_I	0.534	0.41
75_F	120_L	0.534	0.41
125_N	192_L	0.533	0.41
28_I	178_T	0.530	0.41
51_L	189_A	0.529	0.41
31_L	37_A	0.527	0.40
49_E	144_P	0.525	0.40
89_E	104_Q	0.525	0.40
77_L	87_L	0.523	0.40
22_A	26_G	0.519	0.40
103_M	112_M	0.518	0.39
21_A	80_G	0.515	0.39
74_V	153_S	0.514	0.39
23_T	65_V	0.510	0.39
20_S	62_A	0.507	0.38
47_A	189_A	0.506	0.38
6_E	130_E	0.502	0.38
116_A	119_F	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qtaA	2	0.9898	100	0.205	Contact Map
1xkrA	1	0.9898	100	0.289	Contact Map
4hynA	1	0.9745	100	0.36	Contact Map
4fhrA	1	0.9082	100	0.4	Contact Map
4gc8A	1	0.9133	100	0.422	Contact Map
1squA	2	0.7857	99.9	0.541	Contact Map
3hm4A	2	0.7806	99.9	0.548	Contact Map
3h2dA	2	0.7806	99.8	0.552	Contact Map
3hzhB	1	0.7551	99.8	0.574	Contact Map
3uswA	1	0.6837	29.5	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.