Q9HPI5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPI5 - Uncharacterized protein

UniProt:	Q9HPI5	Sequences: MTDTTAVHLEPDDRDAFLAPGGTGVLSFGREDAGPPHSLPVSYGYDPDTESFFFRLSYGDDTDKPDPETTPLDVSFVVHDEADHGWCSVVAHGRLQPTDADAISTTALSALRRVDIPLLDTFDRPLVETEFLFFRLHPDAITARADAPPTT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (135)
Sequences:	1251 (1062)
Seq/√Len:	91.4

HALSA - Q9HPI5 Q9HPS8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_S	38_S	3.747	1.00
95_L	134_F	3.588	1.00
96_Q	135_R	2.818	1.00
28_F	67_P	2.777	1.00
96_Q	137_H	2.664	1.00
21_G	43_Y	2.657	1.00
25_V	77_V	2.558	1.00
74_V	136_L	2.514	1.00
25_V	79_H	2.460	1.00
25_V	38_S	2.457	1.00
51_S	135_R	2.378	1.00
41_V	54_F	2.353	1.00
18_L	78_V	2.312	1.00
28_F	74_V	2.243	1.00
56_L	65_P	2.156	1.00
24_G	76_F	2.089	1.00
97_P	132_L	2.026	1.00
95_L	136_L	2.015	1.00
16_A	20_P	1.873	1.00
23_T	79_H	1.733	1.00
63_D	92_H	1.684	1.00
74_V	95_L	1.679	1.00
29_G	71_P	1.670	1.00
65_P	134_F	1.657	1.00
47_P	50_E	1.637	1.00
13_D	145_A	1.629	1.00
80_D	87_C	1.590	1.00
39_L	90_V	1.563	1.00
43_Y	78_V	1.522	1.00
46_D	110_A	1.495	1.00
103_I	135_R	1.463	1.00
44_G	114_V	1.442	0.99
91_A	141_I	1.416	0.99
11_P	15_D	1.396	0.99
92_H	140_A	1.385	0.99
108_L	131_F	1.376	0.99
54_F	134_F	1.368	0.99
52_F	76_F	1.312	0.99
21_G	78_V	1.301	0.99
105_T	109_S	1.288	0.99
75_S	90_V	1.277	0.99
46_D	106_T	1.256	0.99
44_G	107_A	1.239	0.98
94_R	139_D	1.170	0.98
52_F	91_A	1.168	0.98
43_Y	76_F	1.165	0.98
75_S	92_H	1.158	0.97
22_G	82_A	1.147	0.97
14_R	89_V	1.145	0.97
120_D	124_R	1.133	0.97
65_P	69_T	1.124	0.97
72_L	94_R	1.114	0.97
68_E	95_L	1.087	0.96
52_F	138_P	1.084	0.96
24_G	91_A	1.066	0.96
65_P	132_L	1.055	0.96
6_A	9_L	1.054	0.96
10_E	13_D	1.053	0.96
30_R	63_D	1.053	0.96
51_S	137_H	1.048	0.95
27_S	90_V	1.036	0.95
33_A	73_D	1.031	0.95
97_P	134_F	1.026	0.95
119_L	122_F	1.023	0.95
13_D	87_C	1.004	0.94
38_S	77_V	1.000	0.94
33_A	67_P	1.000	0.94
66_D	69_T	0.988	0.94
93_G	136_L	0.981	0.94
9_L	17_F	0.978	0.93
138_P	141_I	0.972	0.93
46_D	50_E	0.963	0.93
15_D	45_Y	0.962	0.93
42_S	82_A	0.961	0.93
29_G	33_A	0.953	0.93
29_G	67_P	0.949	0.92
43_Y	115_D	0.928	0.92
123_D	128_E	0.928	0.92
73_D	94_R	0.925	0.91
40_P	90_V	0.922	0.91
69_T	132_L	0.921	0.91
40_P	77_V	0.915	0.91
67_P	92_H	0.915	0.91
125_P	128_E	0.914	0.91
9_L	145_A	0.913	0.91
8_H	11_P	0.909	0.91
44_G	110_A	0.907	0.91
125_P	129_T	0.873	0.89
63_D	67_P	0.862	0.88
26_L	41_V	0.836	0.87
112_R	116_I	0.828	0.86
59_G	130_E	0.817	0.85
69_T	97_P	0.812	0.85
14_R	143_A	0.794	0.84
108_L	133_F	0.793	0.84
100_A	103_I	0.790	0.83
76_F	91_A	0.790	0.83
124_R	129_T	0.790	0.83
54_F	136_L	0.787	0.83
85_G	146_D	0.786	0.83
55_R	144_R	0.776	0.82
7_V	146_D	0.769	0.82
28_F	136_L	0.767	0.82
122_F	126_L	0.767	0.82
15_D	19_A	0.764	0.81
106_T	110_A	0.758	0.81
17_F	87_C	0.758	0.81
16_A	19_A	0.755	0.81
79_H	82_A	0.752	0.80
87_C	145_A	0.750	0.80
68_E	97_P	0.746	0.80
7_V	10_E	0.739	0.79
19_A	45_Y	0.738	0.79
30_R	67_P	0.737	0.79
37_H	63_D	0.736	0.79
109_S	113_R	0.733	0.79
104_S	108_L	0.723	0.78
110_A	113_R	0.713	0.77
104_S	133_F	0.710	0.76
91_A	138_P	0.710	0.76
36_P	93_G	0.707	0.76
119_L	123_D	0.702	0.76
86_W	146_D	0.701	0.75
113_R	120_D	0.696	0.75
21_G	80_D	0.689	0.74
124_R	128_E	0.688	0.74
38_S	79_H	0.680	0.73
56_L	134_F	0.678	0.73
16_A	94_R	0.675	0.73
52_F	143_A	0.673	0.72
42_S	84_H	0.672	0.72
84_H	115_D	0.669	0.72
42_S	115_D	0.667	0.72
107_A	133_F	0.666	0.72
16_A	137_H	0.665	0.72
68_E	134_F	0.662	0.71
38_S	75_S	0.653	0.70
10_E	14_R	0.651	0.70
121_T	124_R	0.648	0.70
120_D	123_D	0.647	0.69
73_D	139_D	0.646	0.69
91_A	136_L	0.646	0.69
12_D	16_A	0.640	0.69
67_P	143_A	0.637	0.68
13_D	16_A	0.628	0.67
103_I	107_A	0.625	0.67
103_I	106_T	0.625	0.67
31_E	70_T	0.617	0.66
18_L	76_F	0.616	0.66
15_D	50_E	0.614	0.65
24_G	114_V	0.611	0.65
42_S	112_R	0.610	0.65
58_Y	130_E	0.609	0.65
76_F	138_P	0.608	0.65
56_L	132_L	0.608	0.65
51_S	138_P	0.605	0.64
36_P	71_P	0.605	0.64
109_S	123_D	0.605	0.64
123_D	126_L	0.600	0.64
18_L	89_V	0.596	0.63
16_A	59_G	0.596	0.63
42_S	57_S	0.593	0.63
86_W	144_R	0.586	0.62
28_F	39_L	0.586	0.62
69_T	137_H	0.583	0.61
29_G	36_P	0.583	0.61
83_D	108_L	0.581	0.61
12_D	31_E	0.574	0.60
126_L	129_T	0.572	0.60
7_V	11_P	0.571	0.60
107_A	111_L	0.564	0.59
24_G	78_V	0.563	0.59
25_V	90_V	0.562	0.59
15_D	47_P	0.561	0.59
32_D	106_T	0.557	0.58
87_C	115_D	0.555	0.58
44_G	84_H	0.551	0.57
13_D	45_Y	0.551	0.57
88_S	142_T	0.550	0.57
115_D	144_R	0.544	0.56
14_R	141_I	0.542	0.56
102_A	106_T	0.539	0.56
32_D	73_D	0.538	0.55
28_F	68_E	0.537	0.55
78_V	138_P	0.533	0.55
89_V	141_I	0.533	0.55
18_L	52_F	0.531	0.54
23_T	82_A	0.528	0.54
72_L	96_Q	0.528	0.54
23_T	38_S	0.527	0.54
30_R	70_T	0.527	0.54
16_A	31_E	0.523	0.53
7_V	14_R	0.523	0.53
125_P	131_F	0.522	0.53
20_P	80_D	0.520	0.53
17_F	80_D	0.516	0.52
76_F	89_V	0.515	0.52
54_F	64_K	0.510	0.52
58_Y	132_L	0.508	0.51
33_A	92_H	0.505	0.51
109_S	124_R	0.503	0.51
62_T	108_L	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ol5A	2	0.9139	100	0.416	Contact Map
2vpaA	2	0.9669	100	0.428	Contact Map
2furA	2	0.9272	100	0.445	Contact Map
2htiA	2	0.8344	100	0.447	Contact Map
2fg9A	4	0.9536	99.9	0.459	Contact Map
3u5wA	2	0.8146	99.9	0.495	Contact Map
3fkhA	2	0.8742	99.9	0.5	Contact Map
3cp3A	2	0.8278	99.9	0.501	Contact Map
2hq9A	2	0.8675	99.9	0.506	Contact Map
1rfeA	1	0.9669	99.9	0.508	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.