CBIN - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CBIN - Cobalt transport protein CbiN

UniProt:	Q9HPH5	Sequences: MNRWLAAGGILLGALVVFSFVSAGAWGGADGVAGDTITTINPSYEPWFQSLWTPPSGEIESLLFSIQAAVGGIIIGYYLGRDRPRGQSQDMGSDLP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	96 (86)
Sequences:	433 (319)
Seq/√Len:	34.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_S	59_I	4.260	1.00
72_G	76_G	4.038	1.00
52_W	55_P	3.665	1.00
81_R	84_P	2.937	1.00
24_G	56_S	2.770	1.00
77_Y	83_R	2.708	1.00
84_P	88_S	2.491	1.00
65_S	68_A	2.405	1.00
26_W	65_S	2.079	0.99
34_G	60_E	2.004	0.98
5_L	9_G	1.982	0.98
36_T	39_T	1.935	0.98
10_I	13_G	1.914	0.98
78_Y	82_D	1.816	0.97
68_A	76_G	1.780	0.96
21_V	24_G	1.765	0.96
13_G	17_V	1.723	0.95
7_A	11_L	1.721	0.95
59_I	62_L	1.578	0.93
24_G	59_I	1.485	0.90
27_G	32_V	1.454	0.89
17_V	26_W	1.427	0.88
86_G	89_Q	1.405	0.87
82_D	85_R	1.384	0.87
12_L	51_L	1.298	0.83
38_T	43_S	1.240	0.80
65_S	69_A	1.236	0.80
6_A	73_I	1.199	0.77
37_I	44_Y	1.168	0.76
74_I	78_Y	1.155	0.75
5_L	45_E	1.152	0.75
40_I	43_S	1.139	0.74
69_A	76_G	1.137	0.74
76_G	81_R	1.123	0.73
4_W	7_A	1.067	0.69
7_A	12_L	1.027	0.66
68_A	72_G	1.025	0.65
31_G	45_E	1.024	0.65
35_D	49_Q	0.987	0.62
31_G	35_D	0.972	0.61
34_G	53_T	0.911	0.56
6_A	10_I	0.902	0.56
9_G	13_G	0.896	0.55
18_F	51_L	0.885	0.54
46_P	50_S	0.883	0.54
81_R	85_R	0.880	0.54
4_W	8_G	0.870	0.53
6_A	17_V	0.855	0.52
25_A	62_L	0.850	0.51
50_S	85_R	0.850	0.51
24_G	31_G	0.841	0.50
7_A	19_S	0.834	0.50
31_G	57_G	0.827	0.49
12_L	16_V	0.826	0.49
39_T	53_T	0.824	0.49
23_A	79_L	0.818	0.48
22_S	73_I	0.808	0.48
62_L	75_I	0.806	0.47
11_L	88_S	0.804	0.47
17_V	73_I	0.792	0.46
69_A	72_G	0.772	0.44
65_S	75_I	0.764	0.44
5_L	51_L	0.753	0.43
13_G	48_F	0.752	0.43
29_A	65_S	0.743	0.42
36_T	40_I	0.735	0.41
6_A	9_G	0.732	0.41
15_L	51_L	0.707	0.39
55_P	59_I	0.693	0.38
34_G	38_T	0.686	0.37
29_A	55_P	0.674	0.36
65_S	76_G	0.674	0.36
11_L	15_L	0.672	0.36
38_T	41_N	0.665	0.36
16_V	46_P	0.662	0.36
13_G	22_S	0.656	0.35
27_G	43_S	0.649	0.35
33_A	48_F	0.647	0.34
34_G	45_E	0.646	0.34
8_G	12_L	0.644	0.34
12_L	74_I	0.628	0.33
33_A	66_I	0.625	0.33
21_V	25_A	0.618	0.32
12_L	21_V	0.612	0.32
27_G	31_G	0.605	0.31
31_G	62_L	0.600	0.31
40_I	70_V	0.599	0.31
8_G	88_S	0.596	0.31
37_I	78_Y	0.591	0.30
39_T	45_E	0.588	0.30
6_A	87_Q	0.584	0.30
4_W	41_N	0.576	0.29
55_P	60_E	0.573	0.29
49_Q	88_S	0.573	0.29
74_I	81_R	0.572	0.29
8_G	89_Q	0.571	0.29
27_G	56_S	0.571	0.29
40_I	46_P	0.570	0.29
27_G	49_Q	0.567	0.29
10_I	85_R	0.567	0.29
32_V	35_D	0.566	0.28
13_G	42_P	0.566	0.28
23_A	26_W	0.564	0.28
22_S	86_G	0.563	0.28
32_V	56_S	0.560	0.28
4_W	11_L	0.557	0.28
79_L	87_Q	0.555	0.28
52_W	89_Q	0.554	0.28
21_V	52_W	0.554	0.28
77_Y	81_R	0.551	0.27
69_A	89_Q	0.550	0.27
55_P	69_A	0.548	0.27
37_I	66_I	0.547	0.27
16_V	78_Y	0.545	0.27
12_L	78_Y	0.545	0.27
48_F	79_L	0.542	0.27
52_W	74_I	0.537	0.26
11_L	63_L	0.536	0.26
17_V	21_V	0.533	0.26
50_S	79_L	0.532	0.26
53_T	72_G	0.531	0.26
8_G	11_L	0.531	0.26
29_A	84_P	0.520	0.25
6_A	26_W	0.517	0.25
29_A	68_A	0.517	0.25
17_V	20_F	0.515	0.25
27_G	59_I	0.510	0.25
57_G	74_I	0.509	0.25
42_P	70_V	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rlfG	1	0.9792	24.9	0.93	Contact Map
4tquN	1	0.9688	17	0.935	Contact Map
3d31C	2	0.8125	13.9	0.938	Contact Map
1tacA	1	0.5729	12.2	0.939	Contact Map
3mi9C	1	0.4167	11.3	0.94	Contact Map
4ymuD	2	0.5938	11.2	0.94	Contact Map
4ok4A	2	0.75	11	0.94	Contact Map
2onkC	2	0.8229	10.7	0.941	Contact Map
1p7bA	3	0.8646	10.4	0.941	Contact Map
1mhsA	2	0.7292	9.8	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.