Q9HPF1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HPF1 - Uncharacterized protein

UniProt:	Q9HPF1	Sequences: MDALVVGDTGPLDAALAARAGVTATSHPTEFDVFADDPAAHIAAHDPDTVIVTAPVHTADVPIPAYVDAVSALVDACADRRLVYASTGAVFDGTDGDYRPDDVRTPCDDTGRRIQVFEDHVDRHDTDNGVVLRVSSCYATDPLTPQLAAARDALDGGACQRHDDVYRSPVHVTDVADAITELAETDHTGVFHAPGPRLSVYELHERVLSALGVDTTDLTPAAVPSDTEIARDRSLAGPRFTELLDATVSPPQDAV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	255 (239)
Sequences:	56260 (37782)
Seq/√Len:	2443.9

ECOLI - GALE RMLB1 RMLD GM4D RMLB2 YBJS FCL YFCH HLDD YEEZ QOR2
BACSU - YTCB GALE SPSK YFNG YFHF RMLB YTBQ YWNB YHFK YHEG
HALSA - Q9HPF1 Q9HSV1 Q9HSU9 Q9HS50 Q9HSE7 Q9HRD1 Q9HML4 Q9HNV3 Q9HSQ3 Q9HR86
SULSO - Q7LX44 Q97VN5 Q97UM3 Q7LXG5 Q7LXE8 Q980W1 Q97XJ9 Q97XG1 Q7LXE6 Q97XF9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_R	177_D	2.760	1.00
178_A	193_A	2.684	1.00
191_F	243_L	2.614	1.00
64_P	68_D	2.567	1.00
85_A	179_I	2.539	1.00
49_T	183_A	2.477	1.00
8_D	29_T	2.354	1.00
19_R	180_T	2.318	1.00
52_V	84_Y	2.231	1.00
238_P	242_E	2.189	1.00
134_V	179_I	2.154	1.00
19_R	23_T	2.122	1.00
51_I	183_A	2.114	1.00
241_T	247_T	2.068	1.00
201_Y	205_E	2.067	1.00
99_R	102_D	2.058	1.00
31_F	37_D	2.003	1.00
71_S	120_H	1.992	1.00
199_S	202_E	1.975	1.00
121_V	129_G	1.950	1.00
6_V	52_V	1.950	1.00
132_L	182_L	1.910	1.00
23_T	180_T	1.861	1.00
115_Q	119_D	1.829	1.00
177_D	181_E	1.813	1.00
196_P	241_T	1.765	1.00
68_D	71_S	1.739	1.00
16_L	176_A	1.736	1.00
180_T	184_E	1.734	1.00
23_T	184_E	1.716	1.00
39_A	76_A	1.675	1.00
70_V	117_F	1.674	1.00
5_V	17_A	1.672	1.00
206_R	209_S	1.666	1.00
71_S	75_D	1.654	1.00
152_D	156_G	1.633	1.00
16_L	51_I	1.629	1.00
206_R	210_A	1.612	1.00
16_L	53_T	1.608	1.00
100_P	239_R	1.586	1.00
12_L	137_C	1.562	1.00
53_T	85_A	1.536	1.00
19_R	22_V	1.523	1.00
86_S	90_V	1.522	1.00
237_G	241_T	1.513	1.00
181_E	185_T	1.508	1.00
81_R	130_V	1.502	1.00
110_T	114_I	1.498	1.00
34_F	64_P	1.496	1.00
50_V	77_C	1.495	1.00
19_R	176_A	1.487	1.00
104_R	115_Q	1.459	1.00
135_S	235_L	1.455	1.00
166_Y	197_R	1.455	1.00
85_A	134_V	1.451	1.00
28_P	45_H	1.431	1.00
170_V	175_V	1.428	1.00
48_D	80_R	1.427	1.00
134_V	175_V	1.423	1.00
74_V	124_H	1.422	1.00
125_D	129_G	1.417	1.00
37_D	40_A	1.403	1.00
40_A	44_A	1.400	1.00
119_D	122_D	1.384	1.00
8_D	17_A	1.384	1.00
122_D	131_V	1.379	1.00
78_A	128_N	1.379	1.00
168_S	196_P	1.371	1.00
132_L	179_I	1.328	1.00
51_I	179_I	1.322	1.00
112_R	116_V	1.320	1.00
172_V	176_A	1.303	1.00
24_A	27_H	1.299	1.00
239_R	243_L	1.295	1.00
84_Y	117_F	1.294	1.00
202_E	205_E	1.290	1.00
18_A	141_D	1.276	1.00
19_R	173_T	1.271	1.00
98_Y	102_D	1.267	1.00
20_A	180_T	1.267	1.00
15_A	172_V	1.255	1.00
15_A	173_T	1.253	1.00
4_L	45_H	1.237	1.00
237_G	248_V	1.231	1.00
138_Y	171_H	1.226	1.00
56_V	65_A	1.222	1.00
52_V	70_V	1.219	1.00
84_Y	131_V	1.215	1.00
99_R	236_A	1.213	1.00
66_Y	113_R	1.213	1.00
75_D	78_A	1.212	1.00
3_A	25_T	1.210	1.00
120_H	123_R	1.208	1.00
194_P	235_L	1.206	1.00
122_D	190_V	1.176	1.00
25_T	29_T	1.175	1.00
83_V	132_L	1.167	1.00
77_C	82_L	1.166	1.00
149_A	153_A	1.165	1.00
33_V	69_A	1.163	1.00
25_T	184_E	1.159	1.00
74_V	82_L	1.152	1.00
40_A	43_A	1.150	1.00
91_F	192_H	1.140	1.00
208_L	214_D	1.134	1.00
84_Y	121_V	1.120	1.00
73_L	82_L	1.120	1.00
149_A	152_D	1.114	1.00
171_H	174_D	1.113	1.00
75_D	124_H	1.108	1.00
133_R	190_V	1.104	1.00
122_D	129_G	1.100	1.00
67_V	116_V	1.096	1.00
158_A	219_T	1.089	1.00
65_A	69_A	1.089	1.00
68_D	72_A	1.089	1.00
118_E	133_R	1.087	1.00
14_A	141_D	1.081	1.00
101_D	239_R	1.075	1.00
197_R	234_S	1.072	1.00
208_L	215_T	1.069	1.00
130_V	182_L	1.068	1.00
205_E	208_L	1.061	1.00
174_D	195_G	1.060	1.00
3_A	20_A	1.055	1.00
82_L	121_V	1.052	1.00
166_Y	199_S	1.051	1.00
198_L	202_E	1.050	1.00
24_A	28_P	1.050	1.00
25_T	28_P	1.045	1.00
181_E	184_E	1.038	1.00
3_A	49_T	1.034	1.00
42_I	76_A	1.033	1.00
137_C	175_V	1.025	1.00
15_A	18_A	1.021	1.00
53_T	179_I	1.020	1.00
38_P	76_A	1.014	1.00
11_P	172_V	1.006	1.00
191_F	239_R	1.003	1.00
72_A	75_D	1.002	1.00
18_A	22_V	1.001	1.00
194_P	237_G	0.990	1.00
197_R	232_D	0.990	1.00
238_P	241_T	0.983	1.00
6_V	73_L	0.980	1.00
49_T	81_R	0.979	1.00
133_R	192_H	0.977	1.00
177_D	180_T	0.976	1.00
131_V	190_V	0.975	1.00
116_V	119_D	0.960	1.00
74_V	121_V	0.959	1.00
193_A	240_F	0.957	1.00
33_V	54_A	0.956	1.00
36_D	40_A	0.954	1.00
70_V	121_V	0.952	1.00
11_P	139_A	0.940	1.00
37_D	41_H	0.938	1.00
132_L	193_A	0.934	1.00
41_H	45_H	0.929	1.00
42_I	50_V	0.927	1.00
42_I	45_H	0.926	1.00
166_Y	232_D	0.922	1.00
137_C	170_V	0.920	1.00
78_A	124_H	0.920	1.00
16_L	20_A	0.920	1.00
78_A	127_D	0.920	1.00
239_R	242_E	0.919	1.00
88_G	135_S	0.910	1.00
72_A	76_A	0.910	1.00
182_L	240_F	0.897	1.00
70_V	74_V	0.894	1.00
178_A	240_F	0.894	1.00
86_S	118_E	0.887	1.00
160_Q	221_A	0.885	1.00
81_R	186_D	0.884	1.00
124_H	128_N	0.879	1.00
140_T	171_H	0.879	1.00
208_L	213_V	0.870	1.00
39_A	43_A	0.870	1.00
154_L	208_L	0.866	1.00
50_V	73_L	0.866	1.00
152_D	155_D	0.861	1.00
34_F	65_A	0.854	1.00
3_A	51_I	0.853	1.00
122_D	126_T	0.852	1.00
6_V	54_A	0.850	1.00
187_H	243_L	0.848	1.00
116_V	120_H	0.838	1.00
148_A	152_D	0.836	1.00
202_E	206_R	0.835	1.00
52_V	73_L	0.828	1.00
15_A	19_R	0.826	1.00
3_A	183_A	0.826	1.00
119_D	123_R	0.824	1.00
88_G	235_L	0.819	1.00
92_D	105_T	0.818	1.00
96_G	102_D	0.817	1.00
24_A	29_T	0.810	1.00
17_A	29_T	0.807	1.00
181_E	245_D	0.800	1.00
177_D	246_A	0.800	1.00
36_D	39_A	0.799	1.00
32_D	35_A	0.798	1.00
196_P	237_G	0.798	1.00
74_V	120_H	0.794	1.00
42_I	77_C	0.793	1.00
221_A	224_P	0.792	1.00
135_S	194_P	0.786	1.00
160_Q	163_D	0.784	1.00
212_G	215_T	0.778	1.00
112_R	119_D	0.765	1.00
109_D	112_R	0.764	1.00
112_R	123_R	0.762	1.00
69_A	72_A	0.761	1.00
241_T	248_V	0.759	1.00
90_V	118_E	0.755	1.00
15_A	176_A	0.755	1.00
97_D	236_A	0.752	1.00
108_D	111_G	0.748	1.00
198_L	203_L	0.747	1.00
100_P	240_F	0.742	1.00
95_D	102_D	0.742	1.00
151_R	155_D	0.740	1.00
123_R	127_D	0.739	1.00
12_L	175_V	0.738	1.00
96_G	232_D	0.738	1.00
94_T	98_Y	0.736	1.00
176_A	180_T	0.732	1.00
14_A	18_A	0.732	1.00
161_R	164_D	0.728	1.00
132_L	178_A	0.727	1.00
16_L	179_I	0.726	1.00
26_S	29_T	0.721	1.00
122_D	125_D	0.718	1.00
134_V	137_C	0.715	1.00
136_S	167_R	0.714	1.00
63_I	109_D	0.713	1.00
38_P	72_A	0.710	1.00
71_S	124_H	0.708	1.00
205_E	209_S	0.706	1.00
15_A	141_D	0.704	1.00
158_A	221_A	0.696	1.00
160_Q	219_T	0.695	1.00
4_L	50_V	0.692	1.00
120_H	124_H	0.691	1.00
83_V	179_I	0.689	1.00
83_V	183_A	0.677	1.00
117_F	121_V	0.676	1.00
31_F	38_P	0.676	1.00
49_T	80_R	0.673	1.00
204_H	208_L	0.672	1.00
165_V	200_V	0.671	1.00
125_D	188_T	0.671	1.00
23_T	181_E	0.671	1.00
174_D	177_D	0.670	1.00
23_T	177_D	0.670	1.00
113_R	117_F	0.668	1.00
50_V	82_L	0.668	1.00
106_P	111_G	0.666	1.00
20_A	183_A	0.666	1.00
157_G	213_V	0.664	1.00
230_A	233_R	0.664	1.00
150_A	154_L	0.664	1.00
178_A	246_A	0.663	1.00
198_L	206_R	0.663	1.00
168_S	195_G	0.663	1.00
147_L	150_A	0.662	1.00
15_A	140_T	0.662	1.00
31_F	41_H	0.654	1.00
240_F	248_V	0.654	1.00
142_P	146_Q	0.648	1.00
77_C	80_R	0.648	1.00
160_Q	164_D	0.646	1.00
4_L	41_H	0.645	1.00
25_T	48_D	0.645	1.00
31_F	35_A	0.643	1.00
4_L	42_I	0.643	1.00
89_A	111_G	0.641	1.00
97_D	234_S	0.640	1.00
153_A	157_G	0.637	1.00
56_V	66_Y	0.636	1.00
90_V	104_R	0.635	1.00
41_H	44_A	0.633	1.00
70_V	73_L	0.632	1.00
67_V	71_S	0.631	1.00
106_P	115_Q	0.631	1.00
100_P	192_H	0.631	1.00
153_A	156_G	0.630	1.00
121_V	131_V	0.628	1.00
21_G	27_H	0.626	1.00
52_V	82_L	0.626	1.00
151_R	207_V	0.624	1.00
142_P	145_P	0.623	1.00
49_T	83_V	0.623	1.00
21_G	24_A	0.623	1.00
130_V	191_F	0.622	1.00
17_A	21_G	0.621	1.00
38_P	42_I	0.618	1.00
123_R	126_T	0.614	1.00
83_V	182_L	0.613	1.00
16_L	180_T	0.611	1.00
148_A	153_A	0.607	1.00
181_E	246_A	0.604	1.00
150_A	153_A	0.599	1.00
99_R	238_P	0.598	1.00
191_F	240_F	0.597	1.00
5_V	20_A	0.594	1.00
20_A	25_T	0.590	1.00
166_Y	234_S	0.589	1.00
18_A	173_T	0.588	1.00
187_H	191_F	0.585	1.00
189_G	239_R	0.581	1.00
135_S	168_S	0.581	1.00
175_V	193_A	0.579	1.00
168_S	197_R	0.579	1.00
237_G	246_A	0.577	1.00
125_D	128_N	0.577	1.00
93_G	107_C	0.573	1.00
58_T	61_V	0.569	1.00
55_P	66_Y	0.568	1.00
180_T	183_A	0.565	1.00
35_A	38_P	0.563	1.00
151_R	211_L	0.563	1.00
67_V	120_H	0.560	1.00
90_V	133_R	0.557	1.00
186_D	189_G	0.556	1.00
104_R	119_D	0.555	1.00
25_T	49_T	0.550	1.00
67_V	113_R	0.549	1.00
42_I	73_L	0.547	1.00
208_L	211_L	0.546	1.00
59_A	62_P	0.545	1.00
28_P	44_A	0.544	1.00
87_T	114_I	0.544	1.00
81_R	188_T	0.539	1.00
11_P	15_A	0.536	1.00
140_T	173_T	0.535	1.00
167_R	200_V	0.530	1.00
130_V	188_T	0.528	1.00
130_V	186_D	0.528	1.00
53_T	134_V	0.526	1.00
226_D	229_I	0.526	1.00
17_A	27_H	0.520	1.00
70_V	84_Y	0.519	1.00
93_G	231_R	0.519	1.00
138_Y	195_G	0.517	1.00
181_E	243_L	0.516	1.00
74_V	78_A	0.516	1.00
237_G	240_F	0.515	1.00
109_D	113_R	0.515	1.00
38_P	41_H	0.513	1.00
159_C	162_H	0.513	1.00
240_F	243_L	0.512	1.00
73_L	77_C	0.512	1.00
4_L	31_F	0.502	1.00
153_A	160_Q	0.502	1.00
86_S	133_R	0.501	1.00
136_S	169_P	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1i24A	4	0.9922	100	0.292	Contact Map
2pzmA	2	0.9843	100	0.302	Contact Map
1rpnA	4	1	100	0.303	Contact Map
1n7hA	4	1	100	0.303	Contact Map
1rkxA	3	0.9725	100	0.303	Contact Map
2z1mA	4	1	100	0.307	Contact Map
1vl0A	3	0.9843	100	0.308	Contact Map
2yy7A	2	0.9922	100	0.309	Contact Map
3wmwA	2	0.9451	100	0.311	Contact Map
2pk3A	2	0.9882	100	0.312	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0087 seconds.