RL30 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL30 - 50S ribosomal protein L30P

UniProt:	Q9HPB3	Sequences: MQALVQVRGPVDMSRDIQDTLEMLNIHSVNHCALVPETDTYSGMVAKVNDYVAFGEPSEAVLTDLIESRGEPASGAGDVDDAWVAEHTEYDDVADLAGALLAEETTLSDAGLAPVIRLHPPRGGHDGIKTPASDGGQLGKHTTEEIDHLLTDMR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	154 (151)
Sequences:	682 (423)
Seq/√Len:	34.4

HALSA - RL30
SULSO - RL30

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_A	32_C	6.751	1.00
48_V	52_V	4.372	1.00
56_E	140_K	3.551	1.00
96_L	110_A	3.466	1.00
106_T	109_D	3.145	1.00
72_P	79_V	2.863	1.00
24_L	48_V	2.819	1.00
145_E	148_H	2.777	1.00
61_V	150_L	2.708	1.00
3_A	150_L	2.597	1.00
140_K	143_T	2.533	1.00
63_T	94_A	2.293	0.99
60_A	64_D	2.289	0.99
20_T	44_M	2.128	0.99
132_A	145_E	2.107	0.99
57_P	62_L	2.057	0.98
81_D	93_V	1.988	0.98
2_Q	37_E	1.852	0.97
72_P	112_L	1.806	0.96
30_N	125_H	1.786	0.96
20_T	47_K	1.765	0.96
17_I	21_L	1.680	0.95
53_A	141_H	1.671	0.94
121_P	124_G	1.556	0.92
4_L	35_V	1.527	0.91
82_A	85_A	1.505	0.91
53_A	140_K	1.480	0.90
90_Y	99_A	1.464	0.89
59_E	63_T	1.462	0.89
37_E	42_S	1.453	0.89
59_E	98_G	1.451	0.89
39_D	43_G	1.403	0.87
149_L	153_M	1.384	0.87
73_A	114_P	1.380	0.86
126_D	137_Q	1.379	0.86
13_M	17_I	1.348	0.85
32_C	150_L	1.331	0.84
14_S	17_I	1.317	0.84
85_A	93_V	1.300	0.83
62_L	101_L	1.291	0.82
19_D	23_M	1.280	0.82
81_D	84_V	1.238	0.80
30_N	69_R	1.213	0.78
91_D	95_D	1.210	0.78
82_A	95_D	1.207	0.78
130_T	138_L	1.204	0.78
58_S	64_D	1.201	0.77
12_D	129_K	1.199	0.77
15_R	18_Q	1.196	0.77
15_R	19_D	1.191	0.77
131_P	134_D	1.182	0.76
54_F	140_K	1.181	0.76
141_H	147_D	1.181	0.76
121_P	125_H	1.177	0.76
98_G	102_A	1.175	0.76
25_N	69_R	1.171	0.76
46_A	49_N	1.165	0.75
74_S	84_V	1.140	0.74
70_G	73_A	1.131	0.73
28_S	31_H	1.129	0.73
132_A	135_G	1.128	0.73
133_S	143_T	1.121	0.72
23_M	44_M	1.119	0.72
79_V	112_L	1.104	0.71
64_D	151_T	1.084	0.70
144_E	148_H	1.080	0.70
18_Q	22_E	1.058	0.68
31_H	115_V	1.057	0.68
7_V	52_V	1.040	0.67
4_L	149_L	1.030	0.66
30_N	122_R	1.026	0.66
30_N	120_P	1.017	0.65
35_V	41_Y	1.014	0.65
8_R	12_D	1.014	0.65
64_D	68_S	0.984	0.62
99_A	104_E	0.967	0.61
6_Q	141_H	0.965	0.61
66_I	100_L	0.958	0.60
46_A	143_T	0.950	0.59
127_G	130_T	0.950	0.59
58_S	147_D	0.950	0.59
23_M	102_A	0.949	0.59
137_Q	141_H	0.935	0.58
33_A	115_V	0.915	0.57
33_A	84_V	0.909	0.56
27_H	115_V	0.907	0.56
35_V	126_D	0.901	0.55
125_H	137_Q	0.899	0.55
22_E	27_H	0.892	0.55
74_S	96_L	0.882	0.54
4_L	45_V	0.881	0.54
73_A	77_G	0.879	0.54
76_A	84_V	0.874	0.53
72_P	109_D	0.871	0.53
82_A	86_E	0.870	0.53
3_A	61_V	0.862	0.52
17_I	123_G	0.861	0.52
22_E	28_S	0.860	0.52
58_S	151_T	0.857	0.52
124_G	127_G	0.856	0.52
27_H	31_H	0.854	0.51
138_L	150_L	0.803	0.47
67_E	81_D	0.800	0.47
123_G	131_P	0.788	0.46
120_P	130_T	0.787	0.46
57_P	116_I	0.785	0.46
95_D	98_G	0.781	0.45
83_W	119_H	0.777	0.45
8_R	23_M	0.777	0.45
15_R	23_M	0.761	0.44
88_T	106_T	0.750	0.43
66_I	79_V	0.739	0.42
126_D	133_S	0.739	0.42
42_S	46_A	0.738	0.42
100_L	107_L	0.736	0.41
20_T	35_V	0.735	0.41
10_P	144_E	0.733	0.41
15_R	38_T	0.729	0.41
6_Q	116_I	0.724	0.40
9_G	21_L	0.723	0.40
127_G	135_G	0.722	0.40
84_V	93_V	0.720	0.40
120_P	125_H	0.711	0.39
68_S	104_E	0.711	0.39
38_T	128_I	0.710	0.39
39_D	76_A	0.707	0.39
34_L	100_L	0.706	0.39
11_V	45_V	0.701	0.39
70_G	113_A	0.700	0.39
7_V	123_G	0.694	0.38
30_N	153_M	0.693	0.38
121_P	136_G	0.692	0.38
136_G	139_G	0.689	0.38
66_I	112_L	0.684	0.37
18_Q	24_L	0.678	0.37
32_C	61_V	0.676	0.37
17_I	137_Q	0.673	0.36
58_S	61_V	0.671	0.36
66_I	146_I	0.668	0.36
98_G	107_L	0.657	0.35
17_I	20_T	0.654	0.35
5_V	93_V	0.653	0.35
78_D	116_I	0.652	0.35
29_V	125_H	0.650	0.35
2_Q	42_S	0.648	0.34
143_T	149_L	0.645	0.34
137_Q	140_K	0.644	0.34
96_L	100_L	0.643	0.34
6_Q	9_G	0.639	0.34
44_M	53_A	0.637	0.34
4_L	41_Y	0.634	0.33
128_I	152_D	0.632	0.33
40_T	102_A	0.628	0.33
77_G	145_E	0.627	0.33
92_D	95_D	0.624	0.33
20_T	33_A	0.623	0.33
2_Q	56_E	0.623	0.33
71_E	114_P	0.619	0.32
5_V	52_V	0.615	0.32
64_D	98_G	0.615	0.32
125_H	132_A	0.613	0.32
63_T	68_S	0.613	0.32
10_P	31_H	0.612	0.32
24_L	35_V	0.608	0.31
49_N	54_F	0.608	0.31
86_E	91_D	0.608	0.31
80_D	111_G	0.606	0.31
4_L	40_T	0.605	0.31
99_A	107_L	0.604	0.31
90_Y	98_G	0.602	0.31
59_E	68_S	0.601	0.31
17_I	122_R	0.600	0.31
79_V	84_V	0.598	0.31
5_V	20_T	0.597	0.31
37_E	47_K	0.597	0.31
111_G	115_V	0.593	0.30
30_N	105_T	0.589	0.30
28_S	117_R	0.588	0.30
114_P	117_R	0.588	0.30
148_H	152_D	0.583	0.30
57_P	107_L	0.581	0.29
107_L	113_A	0.579	0.29
85_A	101_L	0.574	0.29
67_E	135_G	0.574	0.29
88_T	109_D	0.574	0.29
2_Q	54_F	0.573	0.29
48_V	138_L	0.568	0.29
18_Q	67_E	0.567	0.29
35_V	123_G	0.564	0.28
57_P	95_D	0.559	0.28
34_L	62_L	0.557	0.28
93_V	132_A	0.556	0.28
75_G	83_W	0.556	0.28
7_V	147_D	0.554	0.28
124_G	136_G	0.554	0.28
59_E	89_E	0.553	0.28
47_K	129_K	0.553	0.28
59_E	112_L	0.552	0.27
133_S	140_K	0.549	0.27
55_G	146_I	0.549	0.27
62_L	65_L	0.548	0.27
92_D	151_T	0.545	0.27
5_V	53_A	0.544	0.27
136_G	149_L	0.542	0.27
66_I	110_A	0.542	0.27
62_L	103_E	0.540	0.27
14_S	109_D	0.540	0.27
119_H	122_R	0.538	0.27
36_P	108_S	0.537	0.26
24_L	52_V	0.535	0.26
119_H	138_L	0.531	0.26
20_T	24_L	0.528	0.26
51_Y	151_T	0.527	0.26
10_P	29_V	0.517	0.25
82_A	98_G	0.516	0.25
28_S	135_G	0.515	0.25
122_R	127_G	0.515	0.25
43_G	153_M	0.514	0.25
24_L	38_T	0.513	0.25
63_T	145_E	0.513	0.25
80_D	92_D	0.512	0.25
7_V	137_Q	0.508	0.25
64_D	91_D	0.507	0.25
26_I	33_A	0.503	0.24
7_V	15_R	0.501	0.24
7_V	37_E	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zkrw	1	0.9805	100	0.094	Contact Map
3j65r	2	0.9935	100	0.098	Contact Map
3zf7w	1	0.9935	100	0.116	Contact Map
3j61F	1	0.9935	100	0.117	Contact Map
4a17V	1	0.9935	100	0.121	Contact Map
1vq8W	1	0.9935	100	0.123	Contact Map
3j39F	1	0.9935	100	0.124	Contact Map
4ujqI	1	0.9935	100	0.124	Contact Map
4w20F	1	0.9935	100	0.125	Contact Map
1vx75	1	0.9935	100	0.13	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.