IF5A - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

IF5A - Translation initiation factor 5A

UniProt:	Q9HP78	Sequences: MAKEQKEVRDLQEGNYVMMEDAACQINAYSTAKPGKHGSAKARIEAEGVFDGKKRSLSQPVDAKIWVPIVNRKQGQIVSKESDTVAQVMDLETYETVTMQIPGELDIQADENIEYLEFEGQRKILQE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (121)
Sequences:	451 (239)
Seq/√Len:	21.7

HALSA - IF5A
SULSO - IF5A

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_M	119_E	5.208	1.00
19_M	46_A	4.551	1.00
11_L	26_I	4.277	1.00
42_A	61_V	3.521	1.00
39_S	63_A	3.076	1.00
86_A	124_I	2.742	0.99
11_L	17_V	2.725	0.99
9_R	62_D	2.709	0.99
22_A	121_Q	2.630	0.99
27_N	47_E	2.542	0.98
43_R	58_S	2.312	0.97
17_V	65_I	2.276	0.96
77_I	111_E	1.955	0.92
115_Y	124_I	1.915	0.91
9_R	29_Y	1.879	0.90
75_G	88_V	1.850	0.89
6_K	10_D	1.794	0.88
6_K	67_V	1.773	0.87
8_V	26_I	1.656	0.83
48_G	51_D	1.628	0.82
36_K	41_K	1.621	0.82
8_V	29_Y	1.605	0.81
37_H	41_K	1.587	0.80
25_Q	31_T	1.462	0.74
37_H	40_A	1.449	0.74
70_V	120_G	1.443	0.73
116_L	125_L	1.383	0.70
48_G	55_R	1.379	0.70
8_V	17_V	1.376	0.70
33_K	59_Q	1.340	0.68
36_K	40_A	1.330	0.67
88_V	113_I	1.312	0.66
4_E	69_I	1.257	0.62
8_V	11_L	1.233	0.61
51_D	55_R	1.218	0.60
8_V	61_V	1.215	0.60
103_G	106_D	1.188	0.58
15_N	67_V	1.127	0.54
89_M	116_L	1.120	0.53
113_I	124_I	1.106	0.53
28_A	45_E	1.106	0.53
29_Y	42_A	1.104	0.52
76_Q	89_M	1.089	0.51
47_E	119_E	1.073	0.50
26_I	29_Y	1.069	0.50
43_R	51_D	1.063	0.50
107_I	110_D	1.036	0.48
88_V	118_F	1.034	0.48
33_K	40_A	1.034	0.48
73_K	86_A	1.031	0.47
87_Q	97_V	1.021	0.47
39_S	57_L	1.015	0.46
87_Q	96_T	1.004	0.46
79_S	87_Q	1.003	0.46
73_K	78_V	0.995	0.45
29_Y	44_I	0.993	0.45
55_R	73_K	0.983	0.44
108_Q	111_E	0.971	0.43
13_E	25_Q	0.970	0.43
17_V	42_A	0.954	0.42
72_R	116_L	0.954	0.42
23_A	45_E	0.949	0.42
9_R	61_V	0.935	0.41
18_M	108_Q	0.930	0.41
112_N	117_E	0.924	0.40
21_D	66_W	0.907	0.39
77_I	86_A	0.901	0.39
7_E	64_K	0.898	0.39
90_D	94_Y	0.876	0.37
70_V	111_E	0.863	0.36
77_I	80_K	0.862	0.36
33_K	60_P	0.861	0.36
16_Y	110_D	0.852	0.36
42_A	123_K	0.851	0.36
27_N	34_P	0.843	0.35
11_L	29_Y	0.829	0.34
39_S	64_K	0.825	0.34
47_E	54_K	0.819	0.34
15_N	93_T	0.816	0.34
8_V	65_I	0.816	0.34
24_C	45_E	0.814	0.33
34_P	43_R	0.814	0.33
16_Y	119_E	0.813	0.33
50_F	56_S	0.807	0.33
79_S	91_L	0.803	0.33
76_Q	116_L	0.800	0.33
45_E	119_E	0.796	0.32
15_N	102_P	0.795	0.32
8_V	42_A	0.791	0.32
7_E	28_A	0.790	0.32
32_A	35_G	0.786	0.32
21_D	52_G	0.784	0.32
38_G	41_K	0.773	0.31
39_S	62_D	0.772	0.31
87_Q	94_Y	0.770	0.31
11_L	103_G	0.764	0.31
10_D	17_V	0.760	0.30
118_F	122_R	0.750	0.30
80_K	101_I	0.745	0.29
76_Q	91_L	0.735	0.29
86_A	101_I	0.728	0.28
9_R	33_K	0.723	0.28
9_R	15_N	0.717	0.28
45_E	116_L	0.716	0.28
61_V	123_K	0.716	0.28
17_V	99_M	0.715	0.28
99_M	124_I	0.710	0.28
36_K	39_S	0.704	0.27
5_Q	45_E	0.699	0.27
21_D	60_P	0.696	0.27
70_V	95_E	0.692	0.27
78_V	95_E	0.690	0.26
5_Q	13_E	0.673	0.26
44_I	61_V	0.664	0.25
73_K	77_I	0.664	0.25
29_Y	62_D	0.663	0.25
44_I	65_I	0.657	0.25
17_V	84_T	0.657	0.25
35_G	41_K	0.656	0.25
74_Q	114_E	0.650	0.24
40_A	60_P	0.648	0.24
14_G	112_N	0.642	0.24
96_T	109_A	0.642	0.24
101_I	106_D	0.639	0.24
67_V	120_G	0.639	0.24
83_D	101_I	0.625	0.23
79_S	123_K	0.620	0.23
12_Q	29_Y	0.606	0.22
75_G	97_V	0.604	0.22
79_S	85_V	0.603	0.22
81_E	110_D	0.603	0.22
22_A	48_G	0.603	0.22
9_R	12_Q	0.603	0.22
60_P	63_A	0.592	0.22
78_V	89_M	0.592	0.22
117_E	120_G	0.589	0.21
13_E	20_E	0.587	0.21
10_D	65_I	0.584	0.21
5_Q	9_R	0.583	0.21
8_V	44_I	0.582	0.21
114_E	117_E	0.579	0.21
39_S	59_Q	0.578	0.21
73_K	90_D	0.578	0.21
27_N	31_T	0.574	0.21
73_K	79_S	0.573	0.21
78_V	87_Q	0.565	0.20
6_K	86_A	0.565	0.20
46_A	55_R	0.564	0.20
77_I	95_E	0.561	0.20
54_K	96_T	0.560	0.20
77_I	85_V	0.557	0.20
117_E	122_R	0.556	0.20
5_Q	64_K	0.553	0.20
108_Q	115_Y	0.553	0.20
31_T	64_K	0.552	0.20
54_K	65_I	0.551	0.20
57_L	63_A	0.551	0.20
73_K	92_E	0.550	0.20
31_T	63_A	0.549	0.20
32_A	62_D	0.543	0.19
47_E	52_G	0.534	0.19
76_Q	79_S	0.530	0.19
10_D	62_D	0.527	0.19
76_Q	110_D	0.527	0.19
92_E	113_I	0.527	0.19
69_I	90_D	0.526	0.19
86_A	102_P	0.522	0.19
42_A	62_D	0.520	0.19
34_P	59_Q	0.513	0.18
86_A	104_E	0.513	0.18
75_G	90_D	0.512	0.18
33_K	54_K	0.511	0.18
23_A	27_N	0.511	0.18
44_I	57_L	0.509	0.18
73_K	89_M	0.509	0.18
71_N	76_Q	0.508	0.18
39_S	78_V	0.508	0.18
77_I	113_I	0.505	0.18
5_Q	33_K	0.504	0.18
83_D	90_D	0.501	0.18
46_A	65_I	0.500	0.18
17_V	46_A	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1khiA	1	0.937	100	0.329	Contact Map
1x6oA	1	0.9606	100	0.392	Contact Map
3er0A	1	0.9921	100	0.405	Contact Map
3hksA	1	1	100	0.407	Contact Map
3cpfA	1	0.9606	100	0.415	Contact Map
1bkbA	3	0.9921	100	0.42	Contact Map
1iz6A	1	0.9921	100	0.431	Contact Map
2eifA	1	0.9921	100	0.441	Contact Map
1ybyA	2	0.9449	99.9	0.568	Contact Map
3a5zB	1	0.9528	99.9	0.577	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.