Q9HP77 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HP77 - Uncharacterized protein

UniProt:	Q9HP77	Sequences: MWVEPPVFRDYVASFTRNLAFHGIDRVVFVNAHGGNVSHLREVGRRLRDEGTLYAVEWMWDESIPELVDEVFDQNGPHGGPKETALMQYLDGEHVHDDRLEDARDGGVASVADADTIKHGSRTFYDAIDNTDNGVLGDQTDATAETGERLFEAASDQLVQLCEWLDAQAFADLLPEPHVST	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	181 (158)
Sequences:	1985 (1497)
Seq/√Len:	119.1

HALSA - Q9HP77 Q9HSQ6
SULSO - Q97V05

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
97_D	100_L	4.058	1.00
4_E	14_S	4.007	1.00
148_E	152_E	3.643	1.00
81_P	146_T	3.554	1.00
89_Y	148_E	3.521	1.00
7_V	14_S	3.317	1.00
6_P	10_D	3.156	1.00
17_R	50_E	3.151	1.00
3_V	11_Y	2.988	1.00
16_T	47_L	2.744	1.00
88_Q	97_D	2.689	1.00
13_A	46_R	2.641	1.00
89_Y	151_F	2.585	1.00
16_T	27_V	2.497	1.00
90_L	151_F	2.402	1.00
102_D	138_D	2.284	1.00
13_A	50_E	2.265	1.00
86_L	151_F	2.107	1.00
85_A	146_T	2.064	1.00
85_A	143_T	2.056	1.00
89_Y	144_A	1.998	1.00
155_S	159_V	1.960	1.00
101_E	133_N	1.850	1.00
7_V	10_D	1.753	1.00
76_G	80_G	1.741	1.00
144_A	148_E	1.739	1.00
91_D	94_H	1.736	1.00
81_P	141_D	1.683	1.00
9_R	43_V	1.652	1.00
152_E	156_D	1.652	1.00
96_H	99_R	1.639	1.00
56_V	161_L	1.637	1.00
143_T	146_T	1.633	1.00
160_Q	163_E	1.628	1.00
16_T	29_F	1.623	1.00
102_D	139_Q	1.613	1.00
20_A	53_L	1.568	1.00
10_D	14_S	1.568	1.00
5_P	39_H	1.563	1.00
4_E	7_V	1.542	1.00
88_Q	142_A	1.513	1.00
12_V	40_L	1.503	1.00
85_A	88_Q	1.503	1.00
17_R	51_G	1.500	1.00
151_F	155_S	1.496	1.00
9_R	42_E	1.495	1.00
28_V	162_C	1.419	1.00
96_H	100_L	1.417	1.00
68_V	150_L	1.324	1.00
159_V	163_E	1.301	1.00
38_S	41_R	1.280	1.00
72_F	76_G	1.275	1.00
145_E	148_E	1.210	0.99
92_G	144_A	1.178	0.99
20_A	25_D	1.157	0.99
88_Q	95_V	1.112	0.99
156_D	160_Q	1.098	0.99
2_W	18_N	1.074	0.98
86_L	150_L	1.069	0.98
9_R	46_R	1.065	0.98
26_R	54_Y	1.045	0.98
127_A	131_T	1.030	0.98
61_D	158_L	1.026	0.98
27_V	53_L	1.023	0.98
19_L	22_H	0.997	0.97
88_Q	144_A	0.996	0.97
13_A	43_V	0.996	0.97
160_Q	164_W	0.994	0.97
33_H	36_N	0.978	0.97
85_A	142_A	0.975	0.97
32_A	60_W	0.973	0.97
32_A	61_D	0.964	0.97
34_G	80_G	0.959	0.97
7_V	18_N	0.958	0.97
28_V	161_L	0.955	0.96
153_A	157_Q	0.951	0.96
40_L	57_E	0.941	0.96
14_S	18_N	0.925	0.96
38_S	45_R	0.917	0.96
97_D	143_T	0.902	0.95
6_P	46_R	0.900	0.95
18_N	21_F	0.890	0.95
4_E	17_R	0.887	0.95
3_V	8_F	0.874	0.94
7_V	11_Y	0.868	0.94
102_D	140_T	0.868	0.94
79_G	127_A	0.866	0.94
35_G	137_G	0.864	0.94
161_L	165_L	0.862	0.94
45_R	49_D	0.861	0.94
6_P	9_R	0.856	0.94
10_D	13_A	0.847	0.93
81_P	85_A	0.843	0.93
79_G	135_V	0.828	0.92
100_L	140_T	0.828	0.92
60_W	76_G	0.825	0.92
44_G	55_A	0.825	0.92
86_L	158_L	0.812	0.92
76_G	137_G	0.802	0.91
57_E	60_W	0.794	0.91
27_V	55_A	0.792	0.91
48_R	125_Y	0.791	0.91
58_W	88_Q	0.789	0.90
145_E	149_R	0.785	0.90
81_P	137_G	0.780	0.90
31_N	36_N	0.776	0.90
17_R	21_F	0.767	0.89
125_Y	129_D	0.766	0.89
59_M	62_E	0.755	0.88
5_P	9_R	0.751	0.88
28_V	165_L	0.745	0.88
84_T	135_V	0.745	0.88
126_D	129_D	0.740	0.87
46_R	50_E	0.737	0.87
29_F	44_G	0.734	0.87
64_I	153_A	0.731	0.87
39_H	42_E	0.718	0.86
35_G	77_P	0.717	0.86
12_V	43_V	0.709	0.85
20_A	51_G	0.707	0.85
31_N	40_L	0.706	0.85
19_L	50_E	0.704	0.85
84_T	95_V	0.702	0.85
36_N	60_W	0.695	0.84
103_A	135_V	0.693	0.84
88_Q	100_L	0.688	0.83
60_W	154_A	0.687	0.83
87_M	91_D	0.685	0.83
28_V	58_W	0.684	0.83
157_Q	160_Q	0.682	0.83
127_A	134_G	0.681	0.83
83_E	95_V	0.679	0.83
37_V	41_R	0.676	0.82
12_V	29_F	0.673	0.82
27_V	162_C	0.671	0.82
38_S	42_E	0.669	0.82
63_S	67_L	0.669	0.82
16_T	20_A	0.666	0.81
87_M	95_V	0.664	0.81
81_P	100_L	0.664	0.81
39_H	43_V	0.659	0.81
64_I	154_A	0.655	0.80
36_N	61_D	0.653	0.80
20_A	27_V	0.652	0.80
84_T	88_Q	0.652	0.80
80_G	84_T	0.646	0.79
84_T	87_M	0.640	0.79
86_L	154_A	0.626	0.77
105_D	108_V	0.626	0.77
58_W	165_L	0.623	0.77
47_L	50_E	0.616	0.76
32_A	141_D	0.614	0.76
60_W	82_K	0.612	0.76
11_Y	47_L	0.610	0.75
142_A	147_G	0.608	0.75
74_Q	138_D	0.608	0.75
61_D	64_I	0.607	0.75
66_E	70_E	0.603	0.75
24_I	44_G	0.601	0.74
63_S	157_Q	0.599	0.74
36_N	80_G	0.599	0.74
31_N	83_E	0.597	0.74
3_V	9_R	0.590	0.73
108_V	111_V	0.590	0.73
138_D	141_D	0.589	0.73
8_F	39_H	0.589	0.73
98_D	101_E	0.588	0.73
47_L	51_G	0.587	0.73
86_L	90_L	0.585	0.72
70_E	156_D	0.583	0.72
23_G	26_R	0.582	0.72
67_L	71_V	0.581	0.72
4_E	10_D	0.577	0.71
153_A	156_D	0.576	0.71
60_W	86_L	0.573	0.71
37_V	61_D	0.572	0.71
48_R	129_D	0.571	0.70
34_G	137_G	0.569	0.70
59_M	158_L	0.568	0.70
35_G	76_G	0.567	0.70
48_R	76_G	0.566	0.70
64_I	130_N	0.565	0.70
71_V	104_R	0.564	0.70
148_E	155_S	0.561	0.69
19_L	26_R	0.560	0.69
20_A	46_R	0.560	0.69
154_A	157_Q	0.559	0.69
124_F	129_D	0.559	0.69
101_E	104_R	0.554	0.68
65_P	69_D	0.553	0.68
81_P	142_A	0.552	0.68
121_S	127_A	0.550	0.68
67_L	70_E	0.546	0.67
31_N	34_G	0.545	0.67
8_F	11_Y	0.544	0.67
47_L	53_L	0.543	0.67
33_H	80_G	0.542	0.67
45_R	79_G	0.542	0.67
16_T	51_G	0.542	0.67
80_G	165_L	0.539	0.66
73_D	156_D	0.538	0.66
24_I	121_S	0.537	0.66
56_V	59_M	0.536	0.66
70_E	149_R	0.536	0.66
75_N	86_L	0.535	0.66
56_V	165_L	0.534	0.65
64_I	67_L	0.532	0.65
25_D	99_R	0.531	0.65
45_R	125_Y	0.527	0.64
84_T	139_Q	0.526	0.64
53_L	66_E	0.525	0.64
2_W	21_F	0.525	0.64
30_V	59_M	0.523	0.64
101_E	160_Q	0.520	0.63
13_A	107_G	0.520	0.63
28_V	156_D	0.519	0.63
158_L	162_C	0.517	0.63
79_G	121_S	0.517	0.63
71_V	145_E	0.516	0.63
6_P	13_A	0.515	0.63
3_V	10_D	0.514	0.62
9_R	13_A	0.514	0.62
13_A	17_R	0.512	0.62
79_G	83_E	0.512	0.62
49_D	55_A	0.511	0.62
29_F	151_F	0.510	0.62
36_N	147_G	0.508	0.62
31_N	39_H	0.507	0.61
10_D	152_E	0.507	0.61
79_G	82_K	0.505	0.61
8_F	42_E	0.504	0.61
5_P	42_E	0.504	0.61
84_T	142_A	0.504	0.61
90_L	142_A	0.503	0.61
41_R	45_R	0.501	0.61
31_N	60_W	0.500	0.60
37_V	154_A	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lubA	4	0.9116	100	0.226	Contact Map
3no4A	5	0.8729	100	0.251	Contact Map
1v7zA	5	0.8785	100	0.254	Contact Map
2lndA	1	0.4641	33.8	0.932	Contact Map
4od6A	1	0.4088	17.5	0.941	Contact Map
1un8A	2	0.8232	17.1	0.941	Contact Map
2zqeA	1	0.4088	15.9	0.942	Contact Map
1ae9A	4	0.5138	15.5	0.942	Contact Map
1yb1A	3	0.6298	13.1	0.944	Contact Map
3bq9A	3	0.9171	12.7	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.