Q9HP71 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HP71 - Uncharacterized protein

UniProt:	Q9HP71	Sequences: MIPLLHDFHGASVLVVGGGAVGARKARRFAAEADRVVVVSPAFGDREFGDADRVRAAPDPDGAADWVARVDPALVVAATSDSDVNAAFAAAARDAGALVNRADVAGDRDHSGDVVVPATAGDPPVTIAVSTGGRSPALSKHLRERIDEEFAGAGGMAVLTGRIRDDLRSTGLSPAERRDAVRAVVRSTPVWKALRTGDANPRVRAEAAVARAVGDVDWST	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	220 (199)
Sequences:	2209 (1716)
Seq/√Len:	121.7

ECOLI - CYSG
BACSU - SIRC
HALSA - Q9HP71

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_D	68_A	4.962	1.00
63_A	91_A	4.952	1.00
14_L	72_P	3.854	1.00
15_V	26_A	3.467	1.00
26_A	47_E	3.144	1.00
23_A	44_G	3.091	1.00
43_F	58_P	2.871	1.00
197_G	200_N	2.824	1.00
70_V	95_A	2.606	1.00
134_R	161_G	2.480	1.00
12_S	37_V	2.469	1.00
131_T	139_S	2.394	1.00
48_F	60_P	2.301	1.00
11_A	73_A	2.137	1.00
79_T	85_N	2.097	1.00
150_F	153_A	2.068	1.00
61_D	64_A	2.030	1.00
87_A	91_A	1.963	1.00
104_V	111_S	1.927	1.00
23_A	46_R	1.922	1.00
76_V	116_V	1.904	1.00
12_S	35_R	1.868	1.00
37_V	72_P	1.859	1.00
93_R	113_D	1.830	1.00
37_V	57_A	1.798	1.00
5_L	128_A	1.782	1.00
2_I	116_V	1.774	1.00
143_R	147_D	1.711	1.00
43_F	47_E	1.709	1.00
84_V	87_A	1.699	1.00
84_V	88_F	1.698	1.00
15_V	36_V	1.662	1.00
125_V	157_A	1.650	1.00
162_R	202_R	1.648	1.00
64_A	67_V	1.639	1.00
173_S	176_E	1.629	1.00
51_A	58_P	1.626	1.00
145_R	149_E	1.565	1.00
6_H	98_L	1.563	1.00
127_I	150_F	1.534	1.00
65_D	87_A	1.523	1.00
48_F	52_D	1.516	1.00
73_A	98_L	1.513	1.00
120_A	147_D	1.499	1.00
86_A	90_A	1.488	1.00
89_A	93_R	1.483	1.00
41_P	62_G	1.468	1.00
120_A	129_V	1.448	1.00
171_G	177_R	1.440	1.00
122_D	147_D	1.432	1.00
49_G	53_R	1.407	1.00
16_V	88_F	1.405	1.00
15_V	29_F	1.393	1.00
141_H	186_R	1.388	1.00
63_A	88_F	1.387	1.00
97_A	113_D	1.359	1.00
81_D	84_V	1.349	1.00
21_V	24_R	1.324	1.00
103_D	112_G	1.315	1.00
43_F	51_A	1.312	1.00
189_P	193_A	1.299	1.00
39_V	68_A	1.266	1.00
4_L	114_V	1.261	1.00
77_A	88_F	1.258	1.00
73_A	96_G	1.224	0.99
35_R	57_A	1.218	0.99
10_G	35_R	1.197	0.99
80_S	85_N	1.188	0.99
127_I	146_I	1.173	0.99
82_S	104_V	1.172	0.99
141_H	145_R	1.165	0.99
18_G	43_F	1.151	0.99
125_V	142_L	1.144	0.99
131_T	157_A	1.138	0.99
75_V	92_A	1.138	0.99
100_N	112_G	1.137	0.99
129_V	142_L	1.128	0.99
124_P	134_R	1.115	0.99
13_V	29_F	1.097	0.99
9_H	33_A	1.093	0.99
64_A	68_A	1.092	0.99
196_T	201_P	1.081	0.98
12_S	72_P	1.077	0.98
89_A	101_R	1.075	0.98
77_A	85_N	1.057	0.98
118_A	143_R	1.057	0.98
43_F	60_P	1.055	0.98
104_V	112_G	1.045	0.98
14_L	39_V	1.044	0.98
31_A	121_G	1.042	0.98
89_A	112_G	1.042	0.98
98_L	113_D	1.040	0.98
138_L	157_A	1.034	0.98
8_F	13_V	1.029	0.98
86_A	111_S	1.026	0.98
11_A	113_D	1.023	0.98
192_K	197_G	1.019	0.98
16_V	63_A	1.018	0.98
44_G	47_E	0.998	0.97
199_A	203_V	0.997	0.97
18_G	22_G	0.982	0.97
160_T	185_V	0.969	0.97
27_R	46_R	0.968	0.97
49_G	52_D	0.966	0.97
166_D	206_E	0.963	0.97
101_R	111_S	0.963	0.97
50_D	55_R	0.961	0.97
51_A	56_A	0.960	0.97
137_A	182_R	0.957	0.97
2_I	28_R	0.957	0.97
30_A	55_R	0.951	0.97
68_A	71_D	0.950	0.97
92_A	97_A	0.947	0.96
136_P	164_R	0.934	0.96
90_A	94_D	0.933	0.96
7_D	115_V	0.925	0.96
41_P	58_P	0.922	0.96
91_A	95_A	0.921	0.96
75_V	97_A	0.920	0.96
154_G	157_A	0.916	0.96
171_G	180_A	0.915	0.96
76_V	114_V	0.914	0.96
165_D	169_S	0.899	0.95
126_T	132_G	0.899	0.95
37_V	59_D	0.888	0.95
45_D	48_F	0.887	0.95
124_P	158_V	0.887	0.95
105_A	112_G	0.884	0.95
23_A	50_D	0.876	0.95
67_V	91_A	0.867	0.94
18_G	40_S	0.863	0.94
123_P	126_T	0.861	0.94
47_E	51_A	0.858	0.94
122_D	154_G	0.856	0.94
89_A	111_S	0.848	0.94
32_E	36_V	0.846	0.94
41_P	84_V	0.845	0.93
172_L	177_R	0.843	0.93
193_A	201_P	0.842	0.93
192_K	200_N	0.835	0.93
171_G	176_E	0.830	0.93
23_A	27_R	0.829	0.93
187_S	190_V	0.822	0.93
46_R	50_D	0.820	0.92
160_T	181_V	0.814	0.92
191_W	194_L	0.811	0.92
36_V	56_A	0.804	0.92
25_K	102_A	0.795	0.91
199_A	202_R	0.790	0.91
89_A	113_D	0.788	0.91
142_L	150_F	0.788	0.91
28_R	119_T	0.787	0.91
67_V	70_V	0.786	0.91
202_R	206_E	0.780	0.90
144_E	186_R	0.778	0.90
117_P	128_A	0.777	0.90
193_A	196_T	0.775	0.90
187_S	201_P	0.773	0.90
141_H	144_E	0.769	0.90
21_V	85_N	0.769	0.90
13_V	34_D	0.767	0.90
177_R	181_V	0.766	0.90
124_P	161_G	0.766	0.90
15_V	18_G	0.761	0.89
26_A	56_A	0.752	0.89
30_A	56_A	0.751	0.89
92_A	99_V	0.751	0.89
201_P	205_A	0.748	0.89
65_D	91_A	0.748	0.89
167_L	180_A	0.747	0.88
40_S	43_F	0.743	0.88
21_V	102_A	0.743	0.88
155_G	198_D	0.737	0.88
115_V	132_G	0.737	0.88
41_P	61_D	0.734	0.88
85_N	168_R	0.733	0.88
2_I	32_E	0.732	0.87
59_D	68_A	0.725	0.87
125_V	131_T	0.713	0.86
144_E	147_D	0.712	0.86
5_L	126_T	0.709	0.86
21_V	80_S	0.707	0.86
198_D	202_R	0.693	0.84
69_R	97_A	0.693	0.84
46_R	49_G	0.692	0.84
193_A	197_G	0.678	0.83
26_A	36_V	0.677	0.83
124_P	154_G	0.677	0.83
138_L	142_L	0.673	0.83
13_V	36_V	0.671	0.83
21_V	101_R	0.670	0.82
140_K	144_E	0.669	0.82
166_D	170_T	0.668	0.82
137_A	178_R	0.667	0.82
112_G	115_V	0.663	0.82
166_D	202_R	0.648	0.80
38_V	56_A	0.643	0.80
15_V	22_G	0.640	0.79
71_D	96_G	0.639	0.79
22_G	78_A	0.639	0.79
69_R	75_V	0.638	0.79
43_F	48_F	0.635	0.79
27_R	50_D	0.635	0.79
122_D	153_A	0.633	0.79
146_I	150_F	0.631	0.78
124_P	157_A	0.627	0.78
123_P	154_G	0.627	0.78
198_D	205_A	0.624	0.78
200_N	203_V	0.622	0.78
53_R	90_A	0.619	0.77
19_G	78_A	0.614	0.77
100_N	118_A	0.613	0.76
112_G	118_A	0.611	0.76
134_R	158_V	0.604	0.75
140_K	182_R	0.604	0.75
85_N	104_V	0.604	0.75
134_R	185_V	0.603	0.75
172_L	176_E	0.601	0.75
111_S	115_V	0.601	0.75
89_A	99_V	0.600	0.75
184_V	189_P	0.600	0.75
67_V	71_D	0.600	0.75
6_H	114_V	0.599	0.75
192_K	201_P	0.597	0.75
137_A	181_V	0.597	0.75
193_A	198_D	0.596	0.74
103_D	118_A	0.595	0.74
84_V	157_A	0.594	0.74
39_V	72_P	0.594	0.74
4_L	74_L	0.592	0.74
47_E	50_D	0.592	0.74
101_R	112_G	0.589	0.74
76_V	113_D	0.584	0.73
199_A	206_E	0.582	0.73
27_R	49_G	0.580	0.72
145_R	150_F	0.579	0.72
18_G	47_E	0.577	0.72
76_V	102_A	0.577	0.72
75_V	88_F	0.574	0.72
190_V	193_A	0.570	0.71
129_V	146_I	0.570	0.71
160_T	180_A	0.568	0.71
2_I	25_K	0.568	0.71
79_T	84_V	0.566	0.71
102_A	116_V	0.566	0.71
25_K	77_A	0.564	0.70
200_N	204_R	0.561	0.70
7_D	105_A	0.559	0.70
125_V	150_F	0.559	0.70
48_F	58_P	0.558	0.70
38_V	43_F	0.556	0.69
67_V	75_V	0.554	0.69
91_A	94_D	0.551	0.69
10_G	94_D	0.548	0.68
78_A	102_A	0.546	0.68
189_P	201_P	0.545	0.68
74_L	78_A	0.544	0.68
21_V	79_T	0.544	0.68
135_S	140_K	0.543	0.68
119_T	126_T	0.541	0.67
181_V	184_V	0.540	0.67
142_L	146_I	0.539	0.67
117_P	132_G	0.537	0.67
163_I	205_A	0.534	0.66
4_L	116_V	0.534	0.66
28_R	121_G	0.534	0.66
19_G	85_N	0.533	0.66
22_G	40_S	0.532	0.66
116_V	128_A	0.528	0.65
146_I	149_E	0.526	0.65
39_V	61_D	0.524	0.65
65_D	95_A	0.523	0.65
18_G	41_P	0.520	0.64
19_G	79_T	0.519	0.64
52_D	82_S	0.518	0.64
187_S	192_K	0.518	0.64
178_R	182_R	0.517	0.64
155_G	158_V	0.517	0.64
77_A	118_A	0.516	0.64
13_V	74_L	0.516	0.64
179_D	186_R	0.514	0.63
29_F	36_V	0.514	0.63
26_A	30_A	0.512	0.63
6_H	113_D	0.511	0.63
24_R	79_T	0.510	0.63
183_A	187_S	0.510	0.63
71_D	97_A	0.510	0.63
187_S	196_T	0.509	0.63
39_V	63_A	0.508	0.62
69_R	72_P	0.508	0.62
79_T	88_F	0.506	0.62
30_A	50_D	0.505	0.62
194_L	197_G	0.505	0.62
118_A	164_R	0.504	0.62
26_A	29_F	0.502	0.62
24_R	117_P	0.501	0.61
137_A	185_V	0.501	0.61
150_F	156_M	0.500	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1pjqA	2	0.9773	100	0.222	Contact Map
1kyqA	2	0.9773	100	0.253	Contact Map
3dfzA	2	0.9045	100	0.288	Contact Map
4d79A	2	0.8545	98.5	0.832	Contact Map
3d4oA	4	0.6545	98.3	0.843	Contact Map
3c85A	2	0.6545	98.3	0.843	Contact Map
2rirA	4	0.6727	98.2	0.848	Contact Map
2g1uA	2	0.5864	98.1	0.85	Contact Map
4b4uA	2	0.5818	98.1	0.851	Contact Map
1id1A	2	0.6455	98	0.856	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.