Q9HP50 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HP50 - Small heat shock protein

UniProt:	Q9HP50	Sequences: MSYDPRLVNDAPRAAATWSAPEQAAPVGAAGMPRQQPQMPQQQPVQDGASQRQAATIDQQPPAATPNVDVIESEAEVVVMIEVPGFSKDEITVQADASNLYVTAERSNDPQMGIEGDDNVLLRECPDRLERAITLPNYIDPGEATAEHVDGVCHVTVPKDEAERQHEIAFQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (134)
Sequences:	2279 (1878)
Seq/√Len:	162.3

BACSU - COTP YOCM
HALSA - Q9HP50 Q9HSS6 Q9HHW1
SULSO - Q97VL9 Q97W19

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
140_D	143_E	4.676	1.00
81_I	102_V	3.533	1.00
104_A	129_L	2.706	1.00
87_S	150_D	2.674	1.00
68_V	81_I	2.544	1.00
73_S	76_E	2.518	1.00
72_E	159_K	2.454	1.00
76_E	156_T	2.392	1.00
92_T	167_E	2.363	1.00
139_I	157_V	2.262	1.00
105_E	128_R	2.159	1.00
82_E	152_V	2.077	1.00
43_Q	47_D	2.051	1.00
83_V	91_I	2.040	1.00
124_E	131_R	1.971	1.00
68_V	133_I	1.948	1.00
92_T	103_T	1.856	1.00
69_D	125_C	1.826	1.00
91_I	148_H	1.796	1.00
78_V	154_H	1.787	1.00
161_E	164_R	1.784	1.00
73_S	78_V	1.733	1.00
66_P	129_L	1.713	1.00
87_S	90_E	1.684	1.00
35_Q	38_Q	1.619	1.00
45_V	48_G	1.563	1.00
72_E	121_L	1.538	1.00
101_Y	132_A	1.514	1.00
100_L	155_V	1.486	1.00
88_K	150_D	1.485	1.00
143_E	158_P	1.475	1.00
103_T	130_E	1.467	1.00
71_I	78_V	1.461	1.00
83_V	148_H	1.457	1.00
86_F	104_A	1.398	1.00
77_V	137_N	1.375	1.00
95_A	135_L	1.359	1.00
100_L	144_A	1.338	1.00
43_Q	46_Q	1.335	1.00
82_E	125_C	1.318	1.00
40_P	43_Q	1.317	1.00
44_P	47_D	1.316	1.00
69_D	123_R	1.288	1.00
43_Q	49_A	1.268	1.00
88_K	92_T	1.252	1.00
80_M	154_H	1.242	1.00
108_N	126_P	1.242	1.00
69_D	80_M	1.238	1.00
68_V	102_V	1.223	1.00
104_A	127_D	1.212	1.00
77_V	144_A	1.188	1.00
70_V	79_V	1.169	1.00
95_A	144_A	1.135	1.00
99_N	132_A	1.130	1.00
47_D	50_S	1.123	1.00
82_E	106_R	1.123	1.00
103_T	128_R	1.116	1.00
140_D	160_D	1.110	1.00
138_Y	160_D	1.105	1.00
66_P	104_A	1.097	1.00
144_A	168_I	1.076	0.99
77_V	138_Y	1.052	0.99
70_V	77_V	1.037	0.99
48_G	51_Q	1.010	0.99
38_Q	41_Q	1.010	0.99
95_A	100_L	0.993	0.99
98_S	141_P	0.987	0.99
41_Q	45_V	0.980	0.99
125_C	152_V	0.978	0.99
94_Q	101_Y	0.969	0.99
36_Q	40_P	0.968	0.99
79_V	157_V	0.962	0.99
141_P	158_P	0.961	0.99
136_P	139_I	0.958	0.99
79_V	123_R	0.932	0.98
138_Y	159_K	0.927	0.98
110_P	115_E	0.925	0.98
94_Q	165_Q	0.924	0.98
99_N	134_T	0.917	0.98
38_Q	45_V	0.911	0.98
46_Q	50_S	0.898	0.98
65_T	69_D	0.890	0.98
46_Q	49_A	0.884	0.98
79_V	133_I	0.877	0.98
137_N	160_D	0.876	0.98
90_E	107_S	0.870	0.98
64_A	104_A	0.869	0.98
135_L	157_V	0.858	0.97
147_E	156_T	0.858	0.97
38_Q	43_Q	0.856	0.97
37_P	40_P	0.851	0.97
91_I	125_C	0.843	0.97
87_S	149_V	0.836	0.97
115_E	118_D	0.828	0.97
75_A	164_R	0.826	0.97
108_N	123_R	0.825	0.97
77_V	159_K	0.815	0.96
71_I	80_M	0.814	0.96
95_A	139_I	0.811	0.96
38_Q	47_D	0.804	0.96
140_D	161_E	0.802	0.96
87_S	148_H	0.797	0.96
69_D	82_E	0.797	0.96
122_L	166_H	0.789	0.96
101_Y	130_E	0.788	0.96
145_T	156_T	0.782	0.96
39_M	43_Q	0.775	0.95
34_R	38_Q	0.774	0.95
66_P	83_V	0.770	0.95
77_V	121_L	0.764	0.95
100_L	168_I	0.760	0.95
114_I	121_L	0.755	0.95
120_V	123_R	0.751	0.94
95_A	141_P	0.747	0.94
106_R	127_D	0.745	0.94
42_Q	47_D	0.745	0.94
163_E	169_A	0.734	0.94
76_E	159_K	0.727	0.93
94_Q	167_E	0.723	0.93
120_V	124_E	0.713	0.93
34_R	37_P	0.708	0.93
42_Q	50_S	0.703	0.92
42_Q	45_V	0.696	0.92
52_R	55_A	0.687	0.91
115_E	119_N	0.686	0.91
86_F	125_C	0.683	0.91
86_F	106_R	0.681	0.91
44_P	48_G	0.679	0.91
36_Q	39_M	0.677	0.91
98_S	137_N	0.667	0.90
80_M	152_V	0.661	0.90
124_E	133_I	0.661	0.90
88_K	169_A	0.659	0.90
91_I	155_V	0.654	0.89
49_A	52_R	0.654	0.89
80_M	125_C	0.653	0.89
107_S	166_H	0.652	0.89
96_D	99_N	0.648	0.89
45_V	52_R	0.647	0.89
96_D	100_L	0.642	0.88
92_T	169_A	0.640	0.88
83_V	104_A	0.633	0.88
39_M	42_Q	0.633	0.88
66_P	124_E	0.632	0.88
36_Q	46_Q	0.630	0.87
144_A	166_H	0.630	0.87
66_P	82_E	0.628	0.87
127_D	148_H	0.627	0.87
100_L	138_Y	0.614	0.86
129_L	144_A	0.611	0.86
72_E	137_N	0.611	0.86
58_D	62_P	0.611	0.86
144_A	158_P	0.610	0.86
71_I	118_D	0.609	0.86
93_V	146_A	0.603	0.85
75_A	156_T	0.602	0.85
80_M	109_D	0.601	0.85
71_I	77_V	0.597	0.84
78_V	156_T	0.596	0.84
135_L	139_I	0.596	0.84
37_P	41_Q	0.588	0.84
121_L	132_A	0.584	0.83
77_V	149_V	0.583	0.83
81_I	148_H	0.579	0.83
70_V	133_I	0.578	0.83
42_Q	46_Q	0.574	0.82
109_D	116_G	0.573	0.82
40_P	44_P	0.571	0.82
55_A	60_Q	0.569	0.82
35_Q	39_M	0.556	0.80
54_A	58_D	0.552	0.80
137_N	169_A	0.550	0.79
149_V	154_H	0.549	0.79
78_V	81_I	0.546	0.79
45_V	49_A	0.546	0.79
91_I	126_P	0.542	0.78
94_Q	103_T	0.539	0.78
59_Q	63_A	0.534	0.77
90_E	118_D	0.533	0.77
44_P	53_Q	0.531	0.77
50_S	118_D	0.531	0.77
40_P	47_D	0.528	0.77
106_R	124_E	0.526	0.76
96_D	165_Q	0.524	0.76
41_Q	44_P	0.524	0.76
145_T	149_V	0.523	0.76
86_F	127_D	0.522	0.76
39_M	49_A	0.515	0.75
124_E	127_D	0.514	0.75
83_V	96_D	0.513	0.74
71_I	120_V	0.511	0.74
79_V	100_L	0.509	0.74
69_D	122_L	0.508	0.74
43_Q	50_S	0.508	0.74
71_I	76_E	0.507	0.74
86_F	129_L	0.505	0.73
58_D	79_V	0.505	0.73
41_Q	52_R	0.502	0.73
86_F	91_I	0.502	0.73
160_D	164_R	0.501	0.73
47_D	51_Q	0.500	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4eldA	4	0.655	100	0.292	Contact Map
3w1zA	7	0.7895	100	0.336	Contact Map
3aabA	2	0.6608	100	0.359	Contact Map
1gmeA	6	0.8246	100	0.36	Contact Map
3glaA	2	0.5789	99.9	0.42	Contact Map
4ydzA	4	0.6901	99.9	0.439	Contact Map
4jutA	4	0.5205	99.9	0.448	Contact Map
2bolA	2	0.924	99.9	0.45	Contact Map
2klrA	2	0.4737	99.9	0.454	Contact Map
3l1eA	2	0.5731	99.9	0.454	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.