Q9HP29 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HP29 - Uncharacterized protein

UniProt:	Q9HP29	Sequences: MHQETVLVPGARDVEATLDEPADGDATACVVACPPHPQHRGHRGDDRLQAVAAALVEDGLACLRFDYGDWDGGMGEREDARNAIRWAGERYAHTAVFGFSFGGSIAALAAATTEHDLWAASLLAPTAELAAGLDAAAALTDVPAPVQVAYATRDTTADWEPVVEAARSDPETTVAELDADHFFVGKHGTVAATVGEFLVGHRRGR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	205 (187)
Sequences:	5158 (3940)
Seq/√Len:	288.1

ECOLI - DLHH FRSA YFHR YGHX YCJY YJFP PLDB
BACSU - YTMA CAH YQKD YTAP YITV YUXL
HALSA - Q9HP29 Q9HPY2 Q9HS46 Q9HN07
SULSO - Q7LX61 Q97YB2 Q97VD6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
95_A	119_A	3.886	1.00
152_T	178_D	3.826	1.00
166_A	172_T	3.001	1.00
21_P	61_A	2.954	1.00
29_C	87_A	2.776	1.00
122_L	125_P	2.608	1.00
159_W	176_E	2.575	1.00
81_R	112_T	2.551	1.00
8_V	83_A	2.516	1.00
7_L	13_D	2.472	1.00
19_D	64_R	2.431	1.00
152_T	176_E	2.424	1.00
29_C	61_A	2.337	1.00
163_V	176_E	2.315	1.00
33_C	80_A	2.276	1.00
95_A	198_L	2.256	1.00
124_A	183_F	2.228	1.00
88_G	116_D	2.197	1.00
175_A	193_T	2.031	1.00
63_L	87_A	1.947	1.00
110_A	120_A	1.910	1.00
106_A	120_A	1.910	1.00
63_L	83_A	1.856	1.00
86_W	90_R	1.837	1.00
70_W	73_G	1.797	1.00
81_R	109_A	1.790	1.00
58_D	195_G	1.787	1.00
134_D	137_A	1.781	1.00
30_V	60_L	1.780	1.00
9_P	13_D	1.760	1.00
146_V	169_D	1.739	1.00
33_C	106_A	1.738	1.00
96_V	106_A	1.721	1.00
80_A	109_A	1.709	1.00
33_C	67_Y	1.704	1.00
68_G	72_G	1.682	1.00
68_G	71_D	1.638	1.00
18_L	63_L	1.613	1.00
149_A	177_L	1.612	1.00
163_V	167_R	1.606	1.00
148_V	162_V	1.590	1.00
54_A	58_D	1.541	1.00
54_A	191_A	1.488	1.00
17_T	43_R	1.478	1.00
123_L	194_V	1.458	1.00
20_E	61_A	1.442	1.00
49_Q	53_A	1.416	1.00
16_A	63_L	1.415	1.00
107_A	122_L	1.393	1.00
138_A	141_D	1.370	1.00
52_A	64_R	1.370	1.00
30_V	97_F	1.344	1.00
18_L	61_A	1.332	1.00
81_R	85_R	1.331	1.00
177_L	193_T	1.321	1.00
150_Y	162_V	1.309	1.00
17_T	64_R	1.285	1.00
99_F	124_A	1.283	1.00
121_S	147_Q	1.258	1.00
65_F	83_A	1.252	1.00
27_T	61_A	1.236	1.00
97_F	121_S	1.221	1.00
189_T	193_T	1.194	1.00
150_Y	159_W	1.186	1.00
85_R	89_E	1.186	1.00
85_R	114_E	1.176	1.00
175_A	189_T	1.173	1.00
192_A	196_E	1.159	1.00
30_V	55_L	1.153	1.00
8_V	16_A	1.141	1.00
31_V	87_A	1.137	1.00
85_R	116_D	1.128	1.00
80_A	105_I	1.120	1.00
97_F	123_L	1.119	1.00
163_V	174_V	1.114	1.00
74_M	108_L	1.108	1.00
7_L	15_E	1.107	1.00
160_E	163_V	1.093	1.00
32_A	97_F	1.085	1.00
24_G	27_T	1.082	1.00
84_I	109_A	1.080	1.00
162_V	174_V	1.075	1.00
34_P	67_Y	1.062	1.00
69_D	72_G	1.051	1.00
159_W	163_V	1.039	1.00
33_C	65_F	1.038	1.00
67_Y	105_I	1.027	1.00
180_D	184_V	1.025	1.00
147_Q	197_F	1.019	1.00
149_A	175_A	1.012	1.00
121_S	198_L	1.003	1.00
68_G	73_G	0.991	1.00
160_E	164_E	0.989	1.00
159_W	174_V	0.987	1.00
164_E	167_R	0.986	1.00
32_A	48_L	0.977	1.00
121_S	194_V	0.976	1.00
54_A	192_A	0.975	1.00
69_D	73_G	0.974	1.00
43_R	66_D	0.973	1.00
18_L	21_P	0.963	1.00
39_H	43_R	0.960	1.00
82_N	85_R	0.958	1.00
31_V	83_A	0.956	1.00
77_R	109_A	0.951	1.00
114_E	117_L	0.946	1.00
14_V	65_F	0.935	1.00
76_E	79_D	0.933	1.00
193_T	196_E	0.930	1.00
136_A	164_E	0.929	1.00
122_L	146_V	0.921	1.00
128_E	161_P	0.917	1.00
95_A	121_S	0.907	1.00
60_L	95_A	0.904	1.00
19_D	62_C	0.903	1.00
51_V	123_L	0.901	1.00
191_A	195_G	0.901	1.00
73_G	76_E	0.898	1.00
136_A	139_L	0.895	1.00
28_A	60_L	0.889	1.00
112_T	138_A	0.881	1.00
78_E	112_T	0.879	1.00
29_C	93_H	0.870	1.00
78_E	81_R	0.868	1.00
84_I	117_L	0.867	1.00
39_H	42_H	0.858	1.00
30_V	95_A	0.848	1.00
120_A	146_V	0.846	1.00
173_T	193_T	0.846	1.00
43_R	64_R	0.845	1.00
31_V	84_I	0.835	1.00
127_A	165_A	0.830	1.00
19_D	56_V	0.828	1.00
10_G	78_E	0.821	1.00
108_L	138_A	0.821	1.00
150_Y	174_V	0.818	1.00
122_L	148_V	0.816	1.00
41_G	45_D	0.811	1.00
148_V	165_A	0.808	0.99
155_T	180_D	0.790	0.99
21_P	27_T	0.787	0.99
65_F	80_A	0.779	0.99
61_A	93_H	0.779	0.99
135_A	139_L	0.779	0.99
55_L	97_F	0.776	0.99
149_A	190_V	0.774	0.99
35_P	41_G	0.767	0.99
54_A	188_G	0.764	0.99
140_T	168_S	0.762	0.99
42_H	45_D	0.758	0.99
125_P	148_V	0.758	0.99
52_A	56_V	0.756	0.99
103_G	106_A	0.755	0.99
32_A	62_C	0.753	0.99
147_Q	175_A	0.750	0.99
148_V	166_A	0.740	0.99
34_P	100_S	0.734	0.99
103_G	125_P	0.734	0.99
77_R	108_L	0.732	0.99
189_T	192_A	0.731	0.99
35_P	100_S	0.729	0.99
23_D	27_T	0.728	0.99
85_R	88_G	0.726	0.99
56_V	62_C	0.722	0.99
125_P	162_V	0.721	0.99
139_L	142_V	0.719	0.99
81_R	114_E	0.717	0.99
86_W	89_E	0.714	0.99
67_Y	101_F	0.712	0.99
161_P	164_E	0.712	0.99
77_R	105_I	0.712	0.99
83_A	87_A	0.711	0.99
26_A	61_A	0.702	0.99
162_V	165_A	0.699	0.99
107_A	146_V	0.697	0.99
17_T	20_E	0.693	0.98
166_A	174_V	0.689	0.98
123_L	183_F	0.683	0.98
40_R	43_R	0.682	0.98
84_I	116_D	0.682	0.98
110_A	142_V	0.681	0.98
117_L	120_A	0.676	0.98
8_V	14_V	0.671	0.98
16_A	83_A	0.670	0.98
101_F	104_S	0.668	0.98
84_I	94_T	0.667	0.98
16_A	65_F	0.663	0.98
190_V	194_V	0.663	0.98
152_T	159_W	0.662	0.98
26_A	92_A	0.655	0.98
15_E	66_D	0.654	0.98
166_A	171_E	0.652	0.98
32_A	52_A	0.651	0.98
148_V	172_T	0.646	0.98
128_E	132_G	0.646	0.98
25_D	28_A	0.643	0.97
107_A	120_A	0.639	0.97
192_A	195_G	0.635	0.97
60_L	195_G	0.631	0.97
123_L	190_V	0.630	0.97
95_A	118_W	0.630	0.97
75_G	79_D	0.623	0.97
67_Y	80_A	0.619	0.97
16_A	19_D	0.619	0.97
80_A	83_A	0.616	0.97
9_P	12_R	0.613	0.97
39_H	44_G	0.613	0.97
15_E	43_R	0.612	0.97
45_D	182_F	0.607	0.96
96_V	117_L	0.606	0.96
21_P	26_A	0.605	0.96
119_A	145_P	0.605	0.96
83_A	86_W	0.604	0.96
77_R	80_A	0.603	0.96
148_V	174_V	0.602	0.96
119_A	197_F	0.602	0.96
99_F	183_F	0.599	0.96
96_V	120_A	0.596	0.96
99_F	123_L	0.595	0.96
35_P	151_A	0.595	0.96
99_F	182_F	0.594	0.96
53_A	57_E	0.592	0.96
129_L	132_G	0.590	0.96
104_S	129_L	0.587	0.96
152_T	163_V	0.586	0.96
128_E	164_E	0.584	0.96
96_V	109_A	0.582	0.96
159_W	162_V	0.582	0.96
42_H	99_F	0.576	0.95
30_V	35_P	0.576	0.95
54_A	57_E	0.574	0.95
47_R	182_F	0.574	0.95
169_D	172_T	0.573	0.95
17_T	44_G	0.570	0.95
121_S	125_P	0.569	0.95
149_A	193_T	0.567	0.95
127_A	161_P	0.566	0.95
188_G	192_A	0.565	0.95
63_L	86_W	0.564	0.95
79_D	82_N	0.563	0.95
191_A	194_V	0.563	0.95
162_V	166_A	0.562	0.95
139_L	169_D	0.561	0.95
126_T	129_L	0.559	0.94
20_E	26_A	0.558	0.94
128_E	134_D	0.555	0.94
119_A	198_L	0.552	0.94
31_V	96_V	0.552	0.94
58_D	192_A	0.550	0.94
186_K	189_T	0.547	0.94
107_A	165_A	0.545	0.94
27_T	93_H	0.542	0.93
139_L	146_V	0.537	0.93
118_W	145_P	0.536	0.93
88_G	118_W	0.536	0.93
156_T	183_F	0.533	0.93
131_A	157_A	0.532	0.93
194_V	198_L	0.532	0.93
40_R	44_G	0.530	0.93
110_A	144_A	0.529	0.93
104_S	107_A	0.524	0.92
82_N	86_W	0.523	0.92
41_G	48_L	0.523	0.92
67_Y	76_E	0.520	0.92
39_H	45_D	0.519	0.92
29_C	91_Y	0.519	0.92
90_R	93_H	0.518	0.92
150_Y	157_A	0.517	0.92
120_A	144_A	0.515	0.92
52_A	62_C	0.514	0.92
70_W	76_E	0.511	0.91
41_G	182_F	0.510	0.91
33_C	105_I	0.509	0.91
60_L	198_L	0.508	0.91
75_G	78_E	0.508	0.91
48_L	123_L	0.506	0.91
188_G	191_A	0.504	0.91
76_E	83_A	0.502	0.91
101_F	105_I	0.502	0.91
84_I	88_G	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2wtmA	2	0.9707	100	0.395	Contact Map
2i3dA	2	0.961	100	0.4	Contact Map
3o4hA	2	0.9805	100	0.404	Contact Map
4wjlA	2	0.9902	100	0.421	Contact Map
3bxpA	2	0.9756	100	0.422	Contact Map
4q3kA	3	0.9854	100	0.424	Contact Map
1xfdA	2	0.9902	100	0.425	Contact Map
3pfbA	2	0.9512	100	0.432	Contact Map
1zi8A	1	0.9317	100	0.433	Contact Map
4q1vA	2	0.9707	100	0.433	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.