Q9HP18 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HP18 - Uncharacterized protein

UniProt:	Q9HP18	Sequences: MRLLAHRGFAGVAPENTLAAVRGAVDRADGIEVDVQPARDGTPVVFHDHRLDDADGARGITDATGAVWDATPDALADADVLGSGAGVPTLAAIADAVTGDTTLHVELKSPGCVTTPGTDGPPQSRWQPFVDSVAAAVADTPVMFSSFFDGALAAARDAAPGVPRAALCVDGQRGLARAAAADCAALHPPVDRIEDTSLVARAHDAGLTVNAWTVDTWLDATRCRRAGVDGVLADYPGVVATTW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	243 (221)
Sequences:	9262 (6774)
Seq/√Len:	455.7

ECOLI - GLPQ UGPQ
BACSU - YHDW GLPQ YQIK
HALSA - Q9HP18

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_A	85_A	3.355	1.00
203_H	229_D	2.941	1.00
23_G	26_D	2.514	1.00
91_A	132_S	2.489	1.00
95_D	136_A	2.489	1.00
71_T	74_A	2.484	1.00
11_G	235_Y	2.449	1.00
22_R	96_A	2.395	1.00
215_D	234_D	2.326	1.00
72_P	76_A	2.296	1.00
21_V	33_V	2.284	1.00
220_A	239_V	2.236	1.00
72_P	89_T	2.183	1.00
76_A	92_A	2.177	1.00
18_L	88_P	2.122	1.00
12_V	237_G	2.063	1.00
46_F	67_V	2.043	1.00
66_A	69_D	2.011	1.00
104_H	145_S	2.005	1.00
91_A	135_A	1.980	1.00
42_T	72_P	1.954	1.00
51_L	78_A	1.942	1.00
33_V	93_I	1.904	1.00
39_R	71_T	1.855	1.00
22_R	26_D	1.850	1.00
38_A	44_V	1.834	1.00
91_A	136_A	1.821	1.00
13_A	23_G	1.778	1.00
235_Y	238_V	1.765	1.00
17_T	80_V	1.760	1.00
25_V	101_T	1.728	1.00
63_A	78_A	1.726	1.00
4_L	30_G	1.707	1.00
45_V	93_I	1.699	1.00
30_G	102_T	1.686	1.00
33_V	45_V	1.662	1.00
89_T	92_A	1.657	1.00
165_A	185_A	1.639	1.00
42_T	89_T	1.639	1.00
190_V	219_D	1.614	1.00
5_A	20_A	1.601	1.00
52_D	64_T	1.595	1.00
44_V	72_P	1.592	1.00
210_N	230_G	1.574	1.00
51_L	70_A	1.536	1.00
65_G	70_A	1.519	1.00
90_L	105_V	1.510	1.00
216_T	219_D	1.505	1.00
128_P	131_D	1.502	1.00
61_T	65_G	1.482	1.00
222_R	226_A	1.474	1.00
144_F	155_A	1.471	1.00
211_A	228_V	1.453	1.00
219_D	222_R	1.450	1.00
130_V	159_A	1.439	1.00
44_V	67_V	1.420	1.00
79_D	84_G	1.418	1.00
21_V	93_I	1.403	1.00
10_A	20_A	1.401	1.00
38_A	42_T	1.392	1.00
132_S	136_A	1.391	1.00
127_Q	158_A	1.391	1.00
37_P	128_P	1.382	1.00
18_L	96_A	1.373	1.00
154_A	158_A	1.371	1.00
37_P	43_P	1.365	1.00
134_A	159_A	1.360	1.00
46_F	60_I	1.357	1.00
9_F	12_V	1.341	1.00
61_T	80_V	1.336	1.00
7_R	15_E	1.336	1.00
75_L	87_V	1.332	1.00
156_R	164_R	1.327	1.00
15_E	53_D	1.327	1.00
144_F	162_V	1.307	1.00
9_F	23_G	1.282	1.00
91_A	95_D	1.279	1.00
42_T	91_A	1.248	1.00
188_P	211_A	1.234	1.00
70_A	74_A	1.234	1.00
38_A	75_L	1.224	1.00
196_T	200_A	1.212	1.00
50_R	66_A	1.205	1.00
131_D	135_A	1.196	1.00
145_S	232_L	1.194	1.00
130_V	155_A	1.188	1.00
35_V	43_P	1.188	1.00
221_T	225_R	1.171	1.00
154_A	157_D	1.162	1.00
53_D	60_I	1.152	1.00
107_L	129_F	1.151	1.00
126_W	151_A	1.145	1.00
41_G	128_P	1.138	1.00
46_F	87_V	1.134	1.00
202_A	209_V	1.112	1.00
199_V	209_V	1.106	1.00
152_L	164_R	1.100	1.00
43_P	129_F	1.093	1.00
127_Q	131_D	1.091	1.00
18_L	22_R	1.087	1.00
38_A	72_P	1.081	1.00
70_A	75_L	1.080	1.00
132_S	135_A	1.078	1.00
156_R	184_A	1.070	1.00
21_V	31_I	1.067	1.00
202_A	207_L	1.066	1.00
79_D	86_G	1.066	1.00
145_S	187_H	1.060	1.00
36_Q	49_H	1.059	1.00
208_T	229_D	1.058	1.00
25_V	96_A	1.056	1.00
74_A	77_D	1.055	1.00
44_V	75_L	1.053	1.00
48_D	53_D	1.042	1.00
35_V	90_L	1.039	1.00
200_A	204_D	1.035	1.00
4_L	230_G	1.034	1.00
4_L	104_H	1.029	1.00
133_V	144_F	1.026	1.00
94_A	133_V	1.023	1.00
19_A	23_G	1.021	1.00
199_V	203_H	1.005	1.00
198_L	202_A	0.995	1.00
10_A	234_D	0.990	1.00
52_D	65_G	0.989	1.00
220_A	231_V	0.989	1.00
50_R	53_D	0.986	1.00
98_T	138_A	0.979	1.00
76_A	86_G	0.979	1.00
214_V	220_A	0.973	1.00
70_A	78_A	0.963	1.00
9_F	237_G	0.963	1.00
159_A	162_V	0.962	1.00
185_A	208_T	0.961	1.00
107_L	151_A	0.957	1.00
138_A	141_P	0.957	1.00
35_V	105_V	0.955	1.00
39_R	69_D	0.940	1.00
214_V	223_C	0.938	1.00
94_A	136_A	0.938	1.00
104_H	210_N	0.937	1.00
3_L	239_V	0.930	1.00
94_A	103_L	0.929	1.00
97_V	103_L	0.921	1.00
126_W	154_A	0.921	1.00
43_P	128_P	0.917	1.00
52_D	62_D	0.915	1.00
21_V	45_V	0.911	1.00
43_P	132_S	0.907	1.00
76_A	89_T	0.906	1.00
138_A	142_V	0.906	1.00
201_R	205_A	0.906	1.00
32_E	47_H	0.905	1.00
217_W	221_T	0.905	1.00
90_L	94_A	0.901	1.00
62_D	65_G	0.899	1.00
212_W	232_L	0.897	1.00
203_H	209_V	0.890	1.00
130_V	134_A	0.889	1.00
187_H	210_N	0.887	1.00
104_H	232_L	0.885	1.00
88_P	93_I	0.883	1.00
127_Q	154_A	0.882	1.00
5_A	28_A	0.880	1.00
16_N	21_V	0.879	1.00
60_I	63_A	0.878	1.00
35_V	129_F	0.870	1.00
104_H	143_M	0.862	1.00
9_F	236_P	0.858	1.00
98_T	136_A	0.858	1.00
134_A	139_D	0.853	1.00
13_A	19_A	0.852	1.00
5_A	9_F	0.850	1.00
79_D	82_G	0.843	1.00
106_E	147_F	0.843	1.00
147_F	167_L	0.828	1.00
139_D	159_A	0.811	1.00
145_S	165_A	0.805	1.00
8_G	21_V	0.801	1.00
148_F	151_A	0.794	1.00
79_D	83_S	0.793	1.00
5_A	10_A	0.791	1.00
134_A	161_G	0.790	1.00
33_V	103_L	0.785	1.00
179_A	205_A	0.780	1.00
201_R	204_D	0.779	1.00
130_V	158_A	0.774	1.00
128_P	132_S	0.773	1.00
104_H	187_H	0.772	1.00
37_P	41_G	0.768	1.00
22_R	97_V	0.768	1.00
211_A	223_C	0.766	1.00
28_A	236_P	0.762	1.00
197_S	201_R	0.761	1.00
220_A	238_V	0.760	1.00
189_P	192_R	0.752	1.00
163_P	184_A	0.751	1.00
199_V	226_A	0.746	1.00
200_A	203_H	0.745	1.00
145_S	167_L	0.743	1.00
185_A	210_N	0.740	1.00
6_H	47_H	0.737	1.00
139_D	142_V	0.733	1.00
224_R	239_V	0.729	1.00
22_R	85_A	0.724	1.00
36_Q	68_W	0.722	1.00
149_D	166_A	0.721	1.00
217_W	238_V	0.720	1.00
42_T	128_P	0.715	1.00
16_N	88_P	0.713	1.00
176_A	180_A	0.712	1.00
9_F	13_A	0.712	1.00
12_V	235_Y	0.711	1.00
107_L	125_R	0.706	1.00
60_I	65_G	0.704	1.00
219_D	223_C	0.703	1.00
24_A	28_A	0.700	1.00
92_A	95_D	0.700	1.00
51_L	75_L	0.700	1.00
112_C	115_T	0.696	1.00
149_D	153_A	0.688	1.00
165_A	187_H	0.688	1.00
31_I	101_T	0.680	1.00
93_I	103_L	0.680	1.00
6_H	32_E	0.679	1.00
4_L	232_L	0.676	1.00
50_R	64_T	0.671	1.00
106_E	146_S	0.670	1.00
129_F	133_V	0.670	1.00
51_L	63_A	0.666	1.00
231_V	239_V	0.662	1.00
133_V	142_V	0.660	1.00
12_V	23_G	0.658	1.00
34_D	47_H	0.657	1.00
93_I	97_V	0.653	1.00
196_T	226_A	0.652	1.00
165_A	210_N	0.652	1.00
49_H	66_A	0.651	1.00
233_A	239_V	0.650	1.00
33_V	105_V	0.648	1.00
73_D	77_D	0.646	1.00
155_A	164_R	0.642	1.00
90_L	129_F	0.642	1.00
3_L	28_A	0.639	0.99
177_R	180_A	0.637	0.99
36_Q	67_V	0.637	0.99
220_A	224_R	0.633	0.99
9_F	28_A	0.628	0.99
133_V	139_D	0.627	0.99
14_P	85_A	0.626	0.99
39_R	74_A	0.625	0.99
193_I	211_A	0.624	0.99
37_P	125_R	0.620	0.99
147_F	212_W	0.618	0.99
61_T	64_T	0.617	0.99
52_D	61_T	0.616	0.99
215_D	233_A	0.614	0.99
216_T	238_V	0.613	0.99
98_T	141_P	0.612	0.99
178_A	181_A	0.612	0.99
100_D	141_P	0.608	0.99
129_F	144_F	0.608	0.99
80_V	88_P	0.605	0.99
223_C	226_A	0.602	0.99
198_L	201_R	0.601	0.99
52_D	63_A	0.598	0.99
25_V	100_D	0.598	0.99
4_L	210_N	0.596	0.99
44_V	89_T	0.593	0.99
75_L	78_A	0.589	0.99
105_V	142_V	0.585	0.99
213_T	233_A	0.583	0.99
31_I	97_V	0.581	0.99
63_A	70_A	0.579	0.99
174_G	177_R	0.576	0.99
218_L	221_T	0.575	0.99
178_A	183_C	0.572	0.99
153_A	157_D	0.565	0.99
99_G	141_P	0.559	0.99
21_V	96_A	0.559	0.99
126_W	130_V	0.559	0.99
211_A	214_V	0.558	0.99
150_G	153_A	0.557	0.99
66_A	70_A	0.556	0.99
94_A	132_S	0.548	0.98
146_S	152_L	0.546	0.98
199_V	228_V	0.546	0.98
224_R	231_V	0.546	0.98
73_D	76_A	0.545	0.98
106_E	167_L	0.545	0.98
178_A	207_L	0.545	0.98
94_A	138_A	0.544	0.98
36_Q	109_S	0.544	0.98
169_V	189_P	0.543	0.98
163_P	208_T	0.542	0.98
3_L	236_P	0.541	0.98
187_H	190_V	0.540	0.98
80_V	87_V	0.540	0.98
30_G	104_H	0.540	0.98
179_A	182_D	0.539	0.98
19_A	22_R	0.539	0.98
196_T	199_V	0.538	0.98
175_L	178_A	0.536	0.98
152_L	156_R	0.534	0.98
175_L	179_A	0.534	0.98
43_P	125_R	0.533	0.98
60_I	80_V	0.532	0.98
102_T	163_P	0.530	0.98
190_V	214_V	0.529	0.98
90_L	132_S	0.528	0.98
31_I	103_L	0.528	0.98
143_M	210_N	0.528	0.98
29_D	102_T	0.526	0.98
176_A	179_A	0.526	0.98
51_L	65_G	0.524	0.98
18_L	21_V	0.524	0.98
178_A	182_D	0.524	0.98
222_R	225_R	0.524	0.98
35_V	45_V	0.524	0.98
195_D	226_A	0.521	0.98
102_T	143_M	0.520	0.98
175_L	205_A	0.519	0.98
189_P	212_W	0.518	0.98
17_T	20_A	0.515	0.98
98_T	103_L	0.513	0.98
210_N	232_L	0.511	0.98
51_L	61_T	0.511	0.98
32_E	108_K	0.510	0.98
155_A	162_V	0.505	0.97
151_A	154_A	0.503	0.97
9_F	24_A	0.500	0.97
89_T	93_I	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2pz0A	2	0.9383	100	0.129	Contact Map
4r7oA	4	0.93	100	0.133	Contact Map
3l12A	2	0.9835	100	0.134	Contact Map
3ks6A	1	0.9465	100	0.135	Contact Map
4oecA	1	0.9053	100	0.143	Contact Map
2oogA	4	0.93	100	0.143	Contact Map
3ch0A	1	0.9794	100	0.144	Contact Map
3qvqA	4	0.9383	100	0.144	Contact Map
2o55A	1	0.9424	100	0.146	Contact Map
2otdA	1	0.9342	100	0.148	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0083 seconds.