Q9HP12 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HP12 - Uncharacterized protein

UniProt:	Q9HP12	Sequences: MDTIAVLPSGFALPPLPHLLAVAALAAAVLVGLRRDPPTVDGRAVLALAPWMVAGSSLYACHQLGLYPSAVAPVFGSPIVYATTAAAAGATWLAVRRFGARPQVLLAGVGAVAAAVPITAALARGWTAGTLTLAWPLGAVGAALVLTAGSWRLLARIRPTDTRAVGVAGVLAVFGHALDATSTAVGVDALGYGEQTPLSTAIIELARALPTAPVVGGGWLFVVVKLALAAGVVVLLAESVRDRPQEGTAILGLVAAVGLGPGVHNVVLFIAANPTGF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	277 (255)
Sequences:	212 (156)
Seq/√Len:	9.8

HALSA - Q9HP12 Q9HPY9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_P	197_P	6.466	1.00
183_T	194_E	3.588	0.97
12_A	15_P	2.961	0.92
59_Y	63_Q	2.907	0.91
107_A	112_V	2.603	0.85
82_A	86_A	2.602	0.85
222_V	229_A	2.350	0.79
87_A	113_A	2.312	0.77
94_A	112_V	2.262	0.76
76_G	195_Q	2.195	0.74
63_Q	264_H	2.138	0.71
178_L	235_L	2.082	0.69
87_A	90_A	2.052	0.68
38_P	252_G	2.050	0.68
46_L	254_V	2.022	0.67
232_V	255_A	1.987	0.66
59_Y	195_Q	1.958	0.64
80_V	268_L	1.945	0.64
59_Y	264_H	1.943	0.64
187_V	228_L	1.930	0.63
108_G	116_V	1.909	0.62
132_T	226_L	1.880	0.61
20_L	147_T	1.862	0.60
60_A	72_A	1.851	0.60
177_A	226_L	1.850	0.60
10_G	59_Y	1.796	0.57
119_T	128_A	1.777	0.57
115_A	118_I	1.766	0.56
251_L	257_V	1.759	0.56
63_Q	195_Q	1.758	0.56
48_L	106_L	1.738	0.55
221_F	224_V	1.730	0.54
90_A	250_I	1.706	0.53
119_T	127_T	1.694	0.53
178_L	182_S	1.672	0.52
63_Q	196_T	1.657	0.51
224_V	233_V	1.635	0.50
226_L	233_V	1.622	0.50
50_P	55_G	1.621	0.50
262_G	266_V	1.620	0.49
56_S	182_S	1.613	0.49
10_G	264_H	1.612	0.49
9_S	14_P	1.606	0.49
10_G	63_Q	1.605	0.49
182_S	265_N	1.584	0.48
224_V	229_A	1.571	0.47
67_Y	266_V	1.570	0.47
32_G	53_V	1.561	0.47
112_V	145_V	1.557	0.47
22_V	262_G	1.550	0.46
17_P	197_P	1.535	0.46
149_G	223_V	1.523	0.45
50_P	110_G	1.521	0.45
52_M	116_V	1.511	0.45
69_S	72_A	1.508	0.44
165_V	236_L	1.506	0.44
111_A	170_V	1.505	0.44
151_W	175_G	1.498	0.44
118_I	205_L	1.495	0.44
140_V	266_V	1.477	0.43
54_A	57_S	1.463	0.42
60_A	79_I	1.447	0.42
94_A	145_V	1.445	0.42
41_D	168_A	1.441	0.41
53_V	114_A	1.438	0.41
75_F	266_V	1.436	0.41
144_L	174_F	1.434	0.41
50_P	81_Y	1.423	0.41
115_A	142_A	1.381	0.39
151_W	262_G	1.379	0.39
252_G	256_A	1.357	0.38
77_S	234_V	1.350	0.38
75_F	89_G	1.349	0.37
62_H	195_Q	1.349	0.37
137_L	226_L	1.348	0.37
74_V	133_L	1.338	0.37
53_V	107_A	1.329	0.37
55_G	81_Y	1.328	0.37
16_L	145_V	1.317	0.36
25_L	149_G	1.297	0.35
169_G	221_F	1.293	0.35
132_T	228_L	1.286	0.35
75_F	96_R	1.284	0.35
12_A	233_V	1.272	0.34
87_A	200_T	1.265	0.34
115_A	145_V	1.259	0.34
244_P	260_G	1.257	0.34
73_P	79_I	1.255	0.34
10_G	196_T	1.255	0.34
183_T	220_L	1.244	0.33
136_P	139_A	1.224	0.32
88_A	267_V	1.223	0.32
72_A	79_I	1.222	0.32
24_A	71_V	1.214	0.32
191_G	198_L	1.205	0.32
169_G	219_W	1.201	0.31
62_H	70_A	1.194	0.31
135_W	189_A	1.189	0.31
64_L	271_A	1.187	0.31
70_A	195_Q	1.185	0.31
63_Q	234_V	1.181	0.31
197_P	221_F	1.177	0.30
132_T	238_E	1.170	0.30
172_A	240_V	1.168	0.30
181_T	224_V	1.162	0.30
47_A	91_T	1.154	0.30
116_V	149_G	1.152	0.30
128_A	200_T	1.151	0.30
80_V	192_Y	1.150	0.29
202_I	220_L	1.144	0.29
199_S	251_L	1.120	0.28
37_P	155_A	1.116	0.28
69_S	79_I	1.107	0.28
188_D	206_A	1.099	0.28
44_A	186_G	1.086	0.27
94_A	109_V	1.080	0.27
11_F	77_S	1.076	0.27
41_D	44_A	1.073	0.27
221_F	256_A	1.072	0.27
195_Q	262_G	1.060	0.26
49_A	227_A	1.056	0.26
10_G	15_P	1.054	0.26
64_L	268_L	1.053	0.26
37_P	67_Y	1.052	0.26
185_V	241_R	1.050	0.26
57_S	233_V	1.048	0.26
132_T	173_V	1.045	0.26
111_A	148_A	1.042	0.26
53_V	237_A	1.039	0.25
47_A	149_G	1.036	0.25
61_C	79_I	1.036	0.25
199_S	203_I	1.029	0.25
63_Q	67_Y	1.029	0.25
65_G	140_V	1.029	0.25
15_P	19_L	1.026	0.25
100_A	198_L	1.025	0.25
18_H	262_G	1.025	0.25
108_G	132_T	1.021	0.25
203_I	217_G	1.016	0.25
20_L	111_A	1.012	0.25
85_A	241_R	1.012	0.25
95_V	133_L	1.007	0.24
98_F	165_V	1.004	0.24
196_T	264_H	1.003	0.24
12_A	197_P	1.003	0.24
92_W	150_S	1.002	0.24
86_A	153_L	1.000	0.24
183_T	199_S	0.998	0.24
68_P	71_V	0.988	0.24
82_A	222_V	0.986	0.24
22_V	249_A	0.985	0.24
44_A	63_Q	0.974	0.23
67_Y	95_V	0.969	0.23
37_P	96_R	0.958	0.23
25_L	113_A	0.955	0.23
118_I	153_L	0.947	0.22
138_G	141_G	0.944	0.22
112_V	133_L	0.940	0.22
147_T	187_V	0.935	0.22
18_H	56_S	0.931	0.22
108_G	118_I	0.927	0.22
142_A	145_V	0.925	0.22
112_V	116_V	0.915	0.21
43_R	122_L	0.908	0.21
172_A	247_G	0.903	0.21
62_H	76_G	0.901	0.21
51_W	227_A	0.900	0.21
206_A	217_G	0.894	0.21
59_Y	196_T	0.894	0.21
139_A	224_V	0.890	0.21
119_T	141_G	0.887	0.21
180_A	225_K	0.881	0.20
14_P	184_A	0.872	0.20
154_L	197_P	0.871	0.20
54_A	117_P	0.870	0.20
118_I	254_V	0.866	0.20
107_A	111_A	0.863	0.20
29_V	233_V	0.863	0.20
23_A	27_A	0.863	0.20
249_A	253_L	0.858	0.20
152_R	204_E	0.854	0.20
37_P	82_A	0.846	0.19
165_V	260_G	0.845	0.19
216_G	226_L	0.841	0.19
15_P	73_P	0.839	0.19
63_Q	76_G	0.839	0.19
55_G	110_G	0.836	0.19
199_S	265_N	0.836	0.19
24_A	157_I	0.835	0.19
77_S	263_V	0.832	0.19
83_T	120_A	0.823	0.19
233_V	251_L	0.823	0.19
58_L	138_G	0.822	0.19
108_G	148_A	0.817	0.19
90_A	227_A	0.813	0.18
81_Y	267_V	0.812	0.18
170_V	270_I	0.811	0.18
186_G	190_L	0.809	0.18
14_P	169_G	0.809	0.18
199_S	254_V	0.806	0.18
111_A	138_G	0.805	0.18
219_W	260_G	0.798	0.18
168_A	205_L	0.798	0.18
20_L	148_A	0.797	0.18
147_T	170_V	0.795	0.18
113_A	254_V	0.794	0.18
12_A	43_R	0.793	0.18
232_V	252_G	0.793	0.18
51_W	102_P	0.787	0.18
61_C	105_L	0.784	0.18
108_G	126_W	0.783	0.18
18_H	57_S	0.781	0.18
175_G	262_G	0.780	0.18
75_F	193_G	0.779	0.18
194_E	202_I	0.777	0.18
93_L	270_I	0.775	0.17
61_C	143_A	0.774	0.17
97_R	113_A	0.774	0.17
60_A	237_A	0.773	0.17
136_P	227_A	0.773	0.17
120_A	138_G	0.771	0.17
11_F	14_P	0.764	0.17
37_P	157_I	0.761	0.17
117_P	233_V	0.760	0.17
52_M	138_G	0.760	0.17
230_A	236_L	0.759	0.17
18_H	266_V	0.755	0.17
20_L	232_V	0.750	0.17
116_V	133_L	0.749	0.17
182_S	268_L	0.747	0.17
67_Y	99_G	0.739	0.17
59_Y	76_G	0.738	0.17
123_A	144_L	0.736	0.16
195_Q	266_V	0.736	0.16
17_P	186_G	0.736	0.16
151_W	235_L	0.732	0.16
155_A	250_I	0.727	0.16
16_L	106_L	0.724	0.16
183_T	265_N	0.724	0.16
138_G	170_V	0.721	0.16
47_A	50_P	0.718	0.16
65_G	202_I	0.718	0.16
30_L	54_A	0.717	0.16
151_W	187_V	0.716	0.16
194_E	199_S	0.715	0.16
30_L	250_I	0.711	0.16
45_V	171_L	0.703	0.16
9_S	63_Q	0.700	0.16
92_W	203_I	0.700	0.16
70_A	237_A	0.697	0.16
83_T	232_V	0.696	0.16
23_A	95_V	0.695	0.15
71_V	93_L	0.694	0.15
133_L	259_L	0.693	0.15
84_T	175_G	0.693	0.15
77_S	242_D	0.690	0.15
176_H	262_G	0.690	0.15
143_A	177_A	0.689	0.15
56_S	60_A	0.686	0.15
66_L	230_A	0.685	0.15
232_V	260_G	0.680	0.15
81_Y	169_G	0.679	0.15
13_L	82_A	0.676	0.15
179_D	261_P	0.676	0.15
11_F	222_V	0.672	0.15
24_A	88_A	0.671	0.15
68_P	235_L	0.668	0.15
40_V	154_L	0.667	0.15
44_A	196_T	0.666	0.15
122_L	125_G	0.666	0.15
10_G	14_P	0.665	0.15
149_G	153_L	0.664	0.15
81_Y	110_G	0.663	0.15
169_G	265_N	0.663	0.15
139_A	205_L	0.661	0.15
40_V	194_E	0.660	0.15
52_M	201_A	0.659	0.15
40_V	183_T	0.656	0.15
233_V	260_G	0.656	0.15
105_L	148_A	0.653	0.15
77_S	262_G	0.653	0.15
13_L	86_A	0.651	0.14
94_A	140_V	0.651	0.14
91_T	115_A	0.649	0.14
16_L	236_L	0.649	0.14
144_L	152_R	0.648	0.14
22_V	261_P	0.644	0.14
249_A	257_V	0.642	0.14
144_L	150_S	0.636	0.14
106_L	250_I	0.636	0.14
127_T	141_G	0.634	0.14
115_A	152_R	0.634	0.14
34_R	204_E	0.631	0.14
126_W	170_V	0.631	0.14
27_A	54_A	0.629	0.14
76_G	102_P	0.628	0.14
32_G	156_R	0.626	0.14
68_P	72_A	0.626	0.14
72_A	134_A	0.623	0.14
15_P	269_F	0.622	0.14
153_L	271_A	0.621	0.14
122_L	130_T	0.620	0.14
19_L	197_P	0.617	0.14
82_A	116_V	0.616	0.14
45_V	54_A	0.616	0.14
86_A	233_V	0.615	0.14
36_D	96_R	0.615	0.14
44_A	94_A	0.614	0.14
194_E	261_P	0.609	0.14
48_L	176_H	0.609	0.14
176_H	188_D	0.608	0.14
108_G	145_V	0.606	0.13
63_Q	75_F	0.606	0.13
60_A	125_G	0.605	0.13
134_A	173_V	0.601	0.13
16_L	101_R	0.598	0.13
65_G	127_T	0.598	0.13
142_A	181_T	0.597	0.13
202_I	257_V	0.597	0.13
197_P	266_V	0.594	0.13
60_A	119_T	0.592	0.13
151_W	199_S	0.588	0.13
24_A	152_R	0.586	0.13
9_S	264_H	0.584	0.13
173_V	252_G	0.583	0.13
131_L	242_D	0.582	0.13
163_R	254_V	0.581	0.13
86_A	116_V	0.575	0.13
19_L	194_E	0.575	0.13
123_A	140_V	0.572	0.13
65_G	239_S	0.572	0.13
52_M	155_A	0.569	0.13
52_M	115_A	0.568	0.13
56_S	257_V	0.567	0.13
52_M	204_E	0.566	0.13
86_A	227_A	0.565	0.13
158_R	241_R	0.561	0.13
152_R	163_R	0.561	0.13
90_A	136_P	0.558	0.12
137_L	232_V	0.554	0.12
11_F	264_H	0.554	0.12
24_A	115_A	0.554	0.12
172_A	233_V	0.553	0.12
16_L	233_V	0.552	0.12
64_L	233_V	0.551	0.12
35_R	233_V	0.549	0.12
20_L	42_G	0.548	0.12
154_L	182_S	0.541	0.12
143_A	174_F	0.541	0.12
20_L	74_V	0.541	0.12
117_P	144_L	0.538	0.12
8_P	219_W	0.538	0.12
92_W	264_H	0.536	0.12
180_A	231_G	0.535	0.12
26_A	175_G	0.533	0.12
184_A	265_N	0.531	0.12
176_H	261_P	0.531	0.12
106_L	224_V	0.531	0.12
195_Q	271_A	0.530	0.12
111_A	131_L	0.526	0.12
86_A	94_A	0.526	0.12
173_V	180_A	0.525	0.12
20_L	255_A	0.524	0.12
106_L	221_F	0.524	0.12
20_L	100_A	0.522	0.12
16_L	255_A	0.521	0.12
64_L	185_V	0.518	0.12
87_A	108_G	0.518	0.12
10_G	195_Q	0.517	0.12
221_F	260_G	0.517	0.12
93_L	108_G	0.517	0.12
21_A	33_L	0.517	0.12
177_A	223_V	0.515	0.12
57_S	267_V	0.515	0.12
137_L	168_A	0.515	0.12
264_H	268_L	0.509	0.12
90_A	100_A	0.505	0.11
147_T	174_F	0.501	0.11
156_R	159_P	0.501	0.11
174_F	236_L	0.500	0.11
42_G	167_V	0.500	0.11
17_P	44_A	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jk0B	1	0.0361	3.9	0.976	Contact Map
4gx0A	3	0.4765	3.4	0.977	Contact Map
2m8fA	1	0.0758	3	0.978	Contact Map
4xnjA	1	0.769	2.8	0.978	Contact Map
4pedA	1	0.2058	2.7	0.978	Contact Map
1uf2K	1	0	2.4	0.979	Contact Map
1j6rA	1	0.1697	2.4	0.979	Contact Map
4c48C	1	0.1372	2.1	0.979	Contact Map
2lq1A	1	0.0614	1.6	0.981	Contact Map
1lddA	4	0.1444	1.6	0.981	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0092 seconds.