DEOC - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DEOC - Deoxyribose-phosphate aldolase

UniProt:	Q9HP08	Sequences: MDRETLAARIDHTVLGPTTTRADVLSVVDDAEAHGMNVCIPPCYVADARDHASADRTIATVIGFPHGTQATSVKVAAAEHAHADGADELDLVIPIGRLKGGDHEAVTAEIAAVNDATPLPVKVIIETPVLTDAEKHAACEAAADADAAMVKTATGFTDGGATVPDVSLMSEYLPVKASGGVGTYADAAAMFDAGAVRIGASSGVDIVASFAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	212 (202)
Sequences:	3199 (2058)
Seq/√Len:	144.8

ECOLI - DEOC
BACSU - DEOC
HALSA - DEOC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
183_T	186_D	3.627	1.00
107_T	144_D	2.974	1.00
80_H	84_D	2.854	1.00
99_K	134_E	2.833	1.00
102_D	105_A	2.779	1.00
143_A	173_L	2.724	1.00
114_N	121_V	2.682	1.00
103_H	137_A	2.671	1.00
174_P	196_V	2.581	1.00
9_R	191_F	2.362	1.00
135_K	165_D	2.343	1.00
107_T	111_A	2.255	1.00
129_V	157_T	2.229	1.00
98_L	103_H	2.219	1.00
25_L	47_D	2.182	1.00
97_R	102_D	2.125	1.00
97_R	105_A	2.118	1.00
37_N	59_A	2.052	1.00
167_S	171_E	1.942	1.00
71_T	75_V	1.871	1.00
137_A	140_E	1.861	1.00
14_V	19_T	1.851	1.00
25_L	51_H	1.829	1.00
91_L	110_I	1.813	1.00
57_T	87_D	1.801	1.00
93_I	98_L	1.787	1.00
163_V	189_A	1.749	1.00
29_D	33_A	1.741	1.00
136_H	172_Y	1.730	1.00
14_V	24_V	1.719	1.00
70_A	80_H	1.659	1.00
184_Y	188_A	1.649	1.00
79_E	83_A	1.604	1.00
78_A	117_T	1.590	1.00
114_N	118_P	1.589	1.00
111_A	115_D	1.556	1.00
188_A	192_D	1.554	1.00
187_A	198_I	1.553	1.00
29_D	51_H	1.529	1.00
132_D	164_P	1.494	1.00
109_E	113_V	1.484	1.00
41_P	66_H	1.476	1.00
128_P	157_T	1.474	1.00
123_V	147_A	1.458	1.00
87_D	119_L	1.451	1.00
73_V	76_A	1.450	1.00
46_A	84_D	1.444	1.00
72_S	80_H	1.424	1.00
49_R	87_D	1.417	1.00
78_A	89_L	1.405	1.00
98_L	138_A	1.383	1.00
10_I	203_G	1.381	1.00
80_H	83_A	1.370	1.00
70_A	84_D	1.369	1.00
25_L	29_D	1.368	1.00
21_R	100_G	1.368	1.00
41_P	68_T	1.364	1.00
131_T	134_E	1.358	1.00
45_V	58_I	1.333	1.00
98_L	141_A	1.329	1.00
93_I	138_A	1.295	1.00
166_V	175_V	1.290	1.00
125_I	135_K	1.290	1.00
186_D	189_A	1.287	1.00
43_C	94_P	1.286	1.00
139_C	169_M	1.280	1.00
182_G	186_D	1.280	1.00
186_D	190_M	1.276	1.00
36_M	203_G	1.273	1.00
69_Q	73_V	1.255	1.00
107_T	141_A	1.243	1.00
82_H	116_A	1.242	1.00
163_V	193_A	1.242	1.00
128_P	158_D	1.229	1.00
21_R	47_D	1.226	1.00
35_G	55_D	1.222	1.00
127_T	178_S	1.213	1.00
20_T	23_D	1.201	1.00
47_D	51_H	1.178	1.00
22_A	25_L	1.167	1.00
136_H	171_E	1.165	1.00
21_R	44_Y	1.160	1.00
170_S	174_P	1.156	1.00
42_P	69_Q	1.155	1.00
185_A	189_A	1.151	1.00
182_G	202_S	1.148	0.99
117_T	121_V	1.144	0.99
37_N	57_T	1.132	0.99
132_D	135_K	1.130	0.99
45_V	60_T	1.127	0.99
69_Q	77_A	1.126	0.99
23_D	26_S	1.124	0.99
42_P	60_T	1.123	0.99
125_I	150_V	1.114	0.99
12_H	203_G	1.111	0.99
32_E	54_A	1.107	0.99
14_V	23_D	1.095	0.99
159_G	162_T	1.091	0.99
82_H	119_L	1.076	0.99
48_A	58_I	1.075	0.99
108_A	112_A	1.068	0.99
71_T	109_E	1.059	0.99
170_S	196_V	1.053	0.99
8_A	35_G	1.022	0.99
120_P	148_A	1.017	0.99
28_V	38_V	1.003	0.99
21_R	25_L	0.995	0.99
136_H	140_E	0.995	0.99
114_N	117_T	0.989	0.98
114_N	148_A	0.987	0.98
127_T	165_D	0.984	0.98
34_H	204_V	0.982	0.98
108_A	111_A	0.976	0.98
139_C	150_V	0.971	0.98
62_I	89_L	0.968	0.98
49_R	58_I	0.966	0.98
163_V	190_M	0.965	0.98
94_P	109_E	0.946	0.98
28_V	51_H	0.944	0.98
185_A	188_A	0.943	0.98
7_A	35_G	0.942	0.98
112_A	115_D	0.936	0.98
164_P	167_S	0.936	0.98
52_A	56_R	0.932	0.98
46_A	50_D	0.931	0.98
21_R	102_D	0.929	0.98
118_P	148_A	0.928	0.98
18_T	129_V	0.923	0.98
17_P	66_H	0.920	0.98
8_A	55_D	0.918	0.98
125_I	138_A	0.918	0.98
39_C	61_V	0.904	0.97
142_A	147_A	0.902	0.97
106_V	109_E	0.901	0.97
36_M	204_V	0.901	0.97
75_V	116_A	0.901	0.97
135_K	168_L	0.892	0.97
107_T	145_A	0.890	0.97
150_V	169_M	0.882	0.97
103_H	141_A	0.880	0.97
39_C	59_A	0.874	0.97
104_E	107_T	0.871	0.97
29_D	32_E	0.871	0.97
74_K	109_E	0.862	0.96
136_H	168_L	0.862	0.96
42_P	70_A	0.857	0.96
142_A	145_A	0.855	0.96
6_L	9_R	0.844	0.96
169_M	175_V	0.841	0.96
63_G	69_Q	0.834	0.96
140_E	172_Y	0.832	0.96
163_V	167_S	0.826	0.95
24_V	44_Y	0.822	0.95
104_E	108_A	0.820	0.95
11_D	37_N	0.820	0.95
76_A	79_E	0.820	0.95
159_G	165_D	0.817	0.95
189_A	193_A	0.806	0.95
142_A	169_M	0.800	0.95
66_H	156_F	0.799	0.95
45_V	84_D	0.799	0.95
26_S	30_D	0.797	0.94
189_A	192_D	0.794	0.94
121_V	148_A	0.793	0.94
127_T	159_G	0.793	0.94
125_I	142_A	0.792	0.94
32_E	53_S	0.791	0.94
13_T	27_V	0.789	0.94
6_L	187_A	0.785	0.94
12_H	30_D	0.785	0.94
70_A	73_V	0.781	0.94
128_P	153_A	0.773	0.94
129_V	158_D	0.772	0.93
5_T	8_A	0.770	0.93
143_A	150_V	0.770	0.93
110_I	147_A	0.768	0.93
200_A	203_G	0.767	0.93
14_V	27_V	0.767	0.93
149_M	174_P	0.766	0.93
75_V	113_V	0.760	0.93
44_Y	100_G	0.757	0.93
75_V	112_A	0.755	0.93
202_S	205_D	0.750	0.92
110_I	142_A	0.749	0.92
153_A	160_G	0.747	0.92
75_V	79_E	0.736	0.92
97_R	100_G	0.732	0.92
32_E	55_D	0.729	0.91
40_I	45_V	0.728	0.91
60_T	81_A	0.724	0.91
89_L	117_T	0.718	0.91
143_A	172_Y	0.717	0.91
135_K	162_T	0.709	0.90
40_I	48_A	0.707	0.90
91_L	113_V	0.705	0.90
9_R	196_V	0.698	0.90
43_C	105_A	0.696	0.89
63_G	77_A	0.695	0.89
94_P	97_R	0.691	0.89
81_A	86_A	0.691	0.89
81_A	84_D	0.687	0.89
43_C	97_R	0.686	0.89
135_K	139_C	0.684	0.89
153_A	161_A	0.681	0.88
167_S	192_D	0.677	0.88
24_V	27_V	0.673	0.88
28_V	52_A	0.670	0.88
187_A	191_F	0.666	0.87
184_Y	206_I	0.654	0.86
66_H	69_Q	0.653	0.86
76_A	80_H	0.653	0.86
62_I	81_A	0.651	0.86
72_S	76_A	0.649	0.86
141_A	145_A	0.648	0.86
135_K	169_M	0.648	0.86
26_S	29_D	0.643	0.85
125_I	169_M	0.641	0.85
127_T	135_K	0.636	0.85
200_A	206_I	0.635	0.85
181_V	202_S	0.632	0.84
140_E	144_D	0.627	0.84
135_K	159_G	0.626	0.84
90_D	151_K	0.626	0.84
91_L	109_E	0.626	0.84
6_L	184_Y	0.626	0.84
91_L	147_A	0.624	0.84
22_A	26_S	0.623	0.83
170_S	173_L	0.622	0.83
78_A	113_V	0.621	0.83
137_A	141_A	0.618	0.83
11_D	59_A	0.617	0.83
99_K	131_T	0.611	0.82
32_E	51_H	0.611	0.82
25_L	28_V	0.604	0.82
177_A	181_V	0.601	0.81
79_E	115_D	0.598	0.81
105_A	108_A	0.596	0.81
118_P	121_V	0.595	0.81
71_T	108_A	0.594	0.80
170_S	175_V	0.591	0.80
45_V	48_A	0.590	0.80
91_L	123_V	0.590	0.80
40_I	60_T	0.588	0.80
63_G	74_K	0.588	0.80
82_H	89_L	0.587	0.80
10_I	36_M	0.587	0.80
113_V	121_V	0.584	0.79
96_G	100_G	0.583	0.79
17_P	158_D	0.581	0.79
140_E	143_A	0.581	0.79
93_I	106_V	0.579	0.79
78_A	82_H	0.573	0.78
7_A	10_I	0.572	0.78
187_A	206_I	0.570	0.78
101_G	106_V	0.570	0.78
71_T	105_A	0.567	0.77
75_V	109_E	0.564	0.77
72_S	84_D	0.562	0.77
31_A	56_R	0.558	0.76
72_S	112_A	0.558	0.76
57_T	120_P	0.557	0.76
128_P	159_G	0.556	0.76
166_V	195_A	0.556	0.76
18_T	23_D	0.556	0.76
15_L	156_F	0.550	0.75
20_T	100_G	0.546	0.75
82_H	117_T	0.541	0.74
170_S	193_A	0.540	0.74
19_T	23_D	0.540	0.74
165_D	168_L	0.537	0.73
95_I	98_L	0.534	0.73
91_L	121_V	0.533	0.73
81_A	89_L	0.531	0.73
93_I	123_V	0.530	0.73
141_A	144_D	0.529	0.72
58_I	87_D	0.528	0.72
89_L	121_V	0.525	0.72
42_P	73_V	0.525	0.72
25_L	50_D	0.524	0.72
125_I	139_C	0.523	0.72
160_G	178_S	0.521	0.71
95_I	129_V	0.521	0.71
184_Y	187_A	0.521	0.71
110_I	123_V	0.518	0.71
101_G	134_E	0.518	0.71
203_G	206_I	0.517	0.71
42_P	62_I	0.514	0.70
9_R	149_M	0.511	0.70
28_V	48_A	0.511	0.70
93_I	125_I	0.510	0.70
181_V	190_M	0.509	0.70
136_H	143_A	0.509	0.70
82_H	113_V	0.509	0.70
44_Y	47_D	0.509	0.70
60_T	89_L	0.508	0.69
166_V	190_M	0.507	0.69
68_T	94_P	0.506	0.69
98_L	137_A	0.505	0.69
17_P	95_I	0.502	0.68
5_T	35_G	0.501	0.68
138_A	145_A	0.501	0.68
139_C	172_Y	0.501	0.68
32_E	56_R	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2a4aA	2	0.9906	100	0.17	Contact Map
4eivA	2	0.9906	100	0.181	Contact Map
1p1xA	1	1	100	0.207	Contact Map
3r12A	2	1	100	0.215	Contact Map
3oa3A	2	0.9953	100	0.221	Contact Map
1vcvA	2	0.9434	100	0.226	Contact Map
3ngjA	4	0.9953	100	0.24	Contact Map
3ndoA	2	0.9953	100	0.275	Contact Map
1ub3A	3	0.967	100	0.331	Contact Map
1n7kA	3	0.9717	100	0.368	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.