Q9HNZ4 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNZ4 - Uncharacterized protein

UniProt:	Q9HNZ4	Sequences: MTVTAMLSVAPVDSPGVDFDAQIASAVDALEEFDVRYRTHPMETTIEADDMAELMAAVTAAHQAVDAPRVGTTLKIDHYREEDLAVEEKVDRVEDRLGRTAASDR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	105 (92)
Sequences:	1005 (570)
Seq/√Len:	59.4

BACSU - YQGV
HALSA - Q9HNZ4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_A	59_T	3.108	1.00
40_H	45_T	2.874	1.00
38_R	87_E	2.646	1.00
84_L	88_E	2.521	1.00
91_D	95_D	2.169	1.00
58_V	74_L	2.136	1.00
20_D	96_R	2.095	1.00
56_A	60_A	1.974	1.00
35_V	46_I	1.931	1.00
5_A	58_V	1.803	0.99
85_A	88_E	1.801	0.99
33_F	60_A	1.755	0.99
32_E	60_A	1.739	0.99
29_A	64_A	1.698	0.99
36_R	87_E	1.671	0.99
10_A	71_G	1.636	0.99
48_A	54_L	1.593	0.99
87_E	91_D	1.558	0.98
42_M	77_D	1.531	0.98
25_S	28_D	1.530	0.98
6_M	75_K	1.530	0.98
21_A	96_R	1.489	0.98
6_M	43_E	1.465	0.98
5_A	54_L	1.442	0.97
28_D	32_E	1.386	0.97
93_V	97_L	1.386	0.97
71_G	75_K	1.377	0.97
41_P	86_V	1.332	0.96
26_A	65_V	1.311	0.96
25_S	66_D	1.304	0.95
62_H	72_T	1.302	0.95
90_V	93_V	1.284	0.95
7_L	58_V	1.279	0.95
7_L	61_A	1.272	0.95
31_E	37_Y	1.210	0.93
62_H	78_H	1.201	0.93
41_P	45_T	1.178	0.92
26_A	61_A	1.169	0.92
92_R	96_R	1.141	0.91
52_A	76_I	1.131	0.91
82_E	85_A	1.123	0.90
30_L	57_A	1.092	0.89
72_T	76_I	1.058	0.87
84_L	87_E	1.052	0.87
13_D	19_F	0.986	0.83
39_T	93_V	0.986	0.83
51_M	54_L	0.978	0.83
26_A	64_A	0.969	0.82
34_D	53_E	0.967	0.82
27_V	39_T	0.957	0.81
10_A	13_D	0.956	0.81
28_D	97_L	0.953	0.81
33_F	57_A	0.948	0.81
55_M	58_V	0.943	0.80
9_V	26_A	0.941	0.80
42_M	89_K	0.933	0.80
53_E	56_A	0.924	0.79
48_A	61_A	0.919	0.79
29_A	61_A	0.912	0.78
35_V	54_L	0.912	0.78
7_L	30_L	0.904	0.78
7_L	46_I	0.903	0.77
59_T	63_Q	0.880	0.76
5_A	74_L	0.875	0.75
51_M	55_M	0.874	0.75
30_L	33_F	0.849	0.73
6_M	45_T	0.849	0.73
4_T	45_T	0.845	0.73
33_F	53_E	0.841	0.72
54_L	61_A	0.838	0.72
29_A	48_A	0.833	0.72
27_V	37_Y	0.833	0.72
94_E	98_G	0.827	0.71
14_S	66_D	0.826	0.71
92_R	95_D	0.825	0.71
30_L	72_T	0.815	0.70
20_D	92_R	0.805	0.69
31_E	94_E	0.793	0.68
46_I	74_L	0.792	0.68
5_A	46_I	0.790	0.67
14_S	22_Q	0.786	0.67
20_D	85_A	0.768	0.65
12_V	71_G	0.757	0.64
8_S	89_K	0.754	0.64
62_H	76_I	0.731	0.61
23_I	89_K	0.721	0.60
40_H	77_D	0.718	0.60
14_S	18_D	0.710	0.59
10_A	73_T	0.709	0.59
25_S	64_A	0.708	0.59
55_M	76_I	0.703	0.58
12_V	19_F	0.701	0.58
56_A	59_T	0.699	0.58
91_D	94_E	0.689	0.57
35_V	48_A	0.675	0.55
38_R	90_V	0.673	0.55
4_T	86_V	0.672	0.55
13_D	67_A	0.662	0.54
61_A	65_V	0.650	0.53
39_T	74_L	0.649	0.53
48_A	55_M	0.644	0.52
81_E	84_L	0.643	0.52
31_E	97_L	0.642	0.52
39_T	94_E	0.630	0.50
72_T	78_H	0.627	0.50
75_K	89_K	0.626	0.50
88_E	92_R	0.624	0.50
35_V	57_A	0.616	0.49
7_L	75_K	0.614	0.49
55_M	59_T	0.609	0.48
18_D	70_V	0.605	0.48
42_M	80_R	0.600	0.47
54_L	62_H	0.597	0.47
38_R	45_T	0.596	0.47
18_D	82_E	0.595	0.46
10_A	30_L	0.586	0.45
29_A	57_A	0.584	0.45
31_E	34_D	0.579	0.45
93_V	96_R	0.575	0.44
36_R	81_E	0.567	0.43
48_A	51_M	0.554	0.42
51_M	61_A	0.547	0.41
25_S	65_V	0.546	0.41
43_E	75_K	0.546	0.41
9_V	86_V	0.542	0.41
9_V	23_I	0.536	0.40
81_E	85_A	0.531	0.39
13_D	79_Y	0.526	0.39
36_R	47_E	0.523	0.39
10_A	72_T	0.523	0.39
70_V	80_R	0.521	0.38
15_P	67_A	0.515	0.38
60_A	64_A	0.514	0.38
60_A	63_Q	0.507	0.37
42_M	45_T	0.506	0.37
63_Q	95_D	0.505	0.37
57_A	64_A	0.500	0.36
95_D	98_G	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1lxjA	4	0.9333	100	0.205	Contact Map
1lxnA	4	0.9143	100	0.225	Contact Map
1yqhA	3	0.9143	100	0.244	Contact Map
2epiA	4	0.8952	100	0.258	Contact Map
2iboA	4	0.8286	100	0.291	Contact Map
1vk8A	4	0.8667	100	0.299	Contact Map
1s99A	2	0.781	99.7	0.559	Contact Map
4f3qA	1	0.7619	28.2	0.921	Contact Map
1konA	1	0.7905	20.6	0.926	Contact Map
4m7tA	1	0.8857	18	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.