Q9HNY6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HNY6 - Uncharacterized protein

UniProt:	Q9HNY6	Sequences: MQQHRANSVNWRRTDSGVELYDETNPDAWIHVDVDPGAPADERPYSVCPDCGVVAPQRTAPTDHMVCGECGAEFDNDERPADDA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	84 (68)
Sequences:	11956 (10019)
Seq/√Len:	1215.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
49_P	68_G	3.715	1.00
54_V	81_A	3.198	1.00
50_D	69_E	2.573	1.00
76_N	79_R	2.449	1.00
66_V	73_E	2.415	1.00
77_D	81_A	2.352	1.00
46_S	66_V	2.176	1.00
55_A	82_D	2.026	1.00
79_R	82_D	2.013	1.00
19_E	22_D	1.931	1.00
36_P	57_Q	1.661	1.00
66_V	71_G	1.630	1.00
52_G	71_G	1.623	1.00
19_E	26_P	1.493	1.00
54_V	57_Q	1.467	1.00
17_G	20_L	1.393	1.00
16_S	19_E	1.385	1.00
29_W	33_D	1.377	1.00
78_E	82_D	1.359	1.00
68_G	73_E	1.342	1.00
75_D	79_R	1.330	1.00
26_P	32_V	1.261	1.00
28_A	31_H	1.228	1.00
22_D	26_P	1.169	1.00
45_Y	48_C	1.149	1.00
50_D	57_Q	1.137	1.00
46_S	52_G	1.105	1.00
29_W	77_D	1.086	1.00
33_D	81_A	1.082	1.00
76_N	80_P	1.031	1.00
21_Y	69_E	1.015	1.00
49_P	57_Q	1.012	1.00
53_V	80_P	1.009	1.00
22_D	28_A	0.996	1.00
21_Y	36_P	0.996	1.00
19_E	35_D	0.995	1.00
15_D	19_E	0.974	1.00
78_E	81_A	0.966	1.00
67_C	83_D	0.954	1.00
31_H	34_V	0.923	1.00
26_P	30_I	0.906	1.00
23_E	26_P	0.888	1.00
56_P	60_A	0.875	1.00
55_A	58_R	0.866	1.00
25_N	38_A	0.851	1.00
24_T	72_A	0.847	1.00
51_C	56_P	0.845	1.00
18_V	21_Y	0.843	1.00
67_C	70_C	0.839	1.00
30_I	34_V	0.829	1.00
53_V	56_P	0.806	1.00
55_A	59_T	0.800	1.00
66_V	69_E	0.793	1.00
48_C	53_V	0.782	1.00
17_G	22_D	0.782	1.00
20_L	68_G	0.753	1.00
51_C	60_A	0.735	1.00
18_V	25_N	0.733	1.00
33_D	36_P	0.731	1.00
48_C	56_P	0.729	1.00
62_T	75_D	0.728	1.00
45_Y	51_C	0.689	1.00
16_S	25_N	0.686	1.00
46_S	49_P	0.684	1.00
20_L	49_P	0.676	1.00
22_D	25_N	0.672	1.00
35_D	39_P	0.667	1.00
23_E	29_W	0.660	1.00
77_D	80_P	0.657	1.00
76_N	82_D	0.619	1.00
24_T	74_F	0.619	1.00
53_V	60_A	0.617	1.00
33_D	54_V	0.612	1.00
48_C	51_C	0.611	1.00
77_D	82_D	0.610	1.00
48_C	60_A	0.609	1.00
23_E	32_V	0.609	1.00
17_G	21_Y	0.604	1.00
59_T	64_H	0.593	1.00
15_D	18_V	0.588	1.00
18_V	27_D	0.588	1.00
64_H	75_D	0.587	1.00
70_C	74_F	0.580	1.00
67_C	74_F	0.574	1.00
65_M	73_E	0.574	1.00
24_T	34_V	0.574	1.00
45_Y	56_P	0.570	1.00
33_D	37_G	0.564	1.00
27_D	75_D	0.552	1.00
70_C	83_D	0.552	1.00
29_W	32_V	0.543	1.00
30_I	33_D	0.540	1.00
49_P	52_G	0.539	1.00
69_E	80_P	0.527	1.00
66_V	80_P	0.524	1.00
30_I	35_D	0.520	1.00
55_A	76_N	0.517	1.00
25_N	31_H	0.516	1.00
38_A	42_E	0.512	1.00
59_T	63_D	0.511	1.00
19_E	24_T	0.502	1.00
30_I	38_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3w5kB	1	0.9048	98.9	0.359	Contact Map
2i13A	1	0.9524	98.9	0.366	Contact Map
2rsjA	1	0.9048	98.9	0.372	Contact Map
2kmkA	1	0.8095	98.8	0.389	Contact Map
4x9jA	1	0.8333	98.8	0.394	Contact Map
2dmdA	1	0.8929	98.8	0.394	Contact Map
2m9aA	1	0.8452	98.8	0.396	Contact Map
2lt7A	1	0.9643	98.8	0.396	Contact Map
2ee8A	1	0.9881	98.8	0.401	Contact Map
2n25A	1	0.3452	98.7	0.406	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.