CRCB1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CRCB1 - Putative fluoride ion transporter CrcB 1

UniProt:	Q9HNW2	Sequences: MTGAVAPPAVLVAAGGALGAVLRWRVVAATPTTEYPAGTLVVNVVGSFVLAALTFAAADADTMLLFGTGACGAFTTFASFSVDVVALVDADRPVAAAGHALGNLLGAGLAVALAWLLVA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	119 (110)
Sequences:	4197 (3233)
Seq/√Len:	308.2

ECOLI - CRCB
BACSU - CRCB1 CRCB2
HALSA - CRCB1 CRCB2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_V	74_F	4.083	1.00
46_G	75_T	3.979	1.00
50_L	67_G	3.042	1.00
16_G	20_A	3.008	1.00
13_A	17_A	2.803	1.00
44_V	110_A	2.505	1.00
99_H	103_N	2.260	1.00
17_A	73_A	2.241	1.00
15_G	65_L	2.221	1.00
22_L	70_A	2.081	1.00
84_V	100_A	1.901	1.00
44_V	106_G	1.899	1.00
55_F	115_W	1.878	1.00
26_V	42_V	1.728	1.00
84_V	99_H	1.716	1.00
84_V	96_A	1.694	1.00
47_S	107_A	1.637	1.00
53_L	66_F	1.595	1.00
18_L	70_A	1.578	1.00
41_V	45_V	1.541	1.00
18_L	65_L	1.488	1.00
92_R	95_A	1.488	1.00
42_V	74_F	1.446	1.00
50_L	111_V	1.427	1.00
24_W	28_A	1.414	1.00
40_L	102_G	1.403	1.00
22_L	74_F	1.369	1.00
9_A	21_V	1.360	1.00
30_T	38_G	1.358	1.00
48_F	114_A	1.331	1.00
48_F	117_L	1.327	1.00
17_A	21_V	1.320	1.00
86_A	89_D	1.315	1.00
49_V	71_C	1.307	1.00
112_A	116_L	1.275	1.00
25_R	29_A	1.267	1.00
53_L	67_G	1.251	1.00
20_A	73_A	1.241	1.00
52_A	56_A	1.240	1.00
21_V	25_R	1.236	1.00
50_L	71_C	1.230	1.00
13_A	21_V	1.223	1.00
8_P	64_L	1.221	1.00
39_T	83_D	1.213	1.00
32_T	37_A	1.211	1.00
54_T	82_V	1.198	1.00
97_A	101_L	1.196	1.00
50_L	73_A	1.160	1.00
27_V	42_V	1.084	1.00
88_V	96_A	1.050	1.00
48_F	110_A	1.036	1.00
65_L	70_A	1.006	1.00
35_Y	40_L	0.996	1.00
79_S	83_D	0.994	1.00
102_G	106_G	0.987	1.00
40_L	106_G	0.981	1.00
40_L	44_V	0.981	1.00
64_L	68_T	0.977	1.00
94_V	97_A	0.962	1.00
88_V	93_P	0.961	1.00
52_A	55_F	0.946	1.00
54_T	67_G	0.901	1.00
85_V	111_V	0.899	1.00
83_D	86_A	0.899	1.00
81_S	104_L	0.897	1.00
102_G	105_L	0.885	1.00
85_V	115_W	0.884	1.00
106_G	110_A	0.880	1.00
113_L	116_L	0.873	1.00
14_A	17_A	0.847	1.00
27_V	31_P	0.844	1.00
38_G	42_V	0.843	1.00
85_V	112_A	0.842	1.00
12_V	64_L	0.838	1.00
63_M	67_G	0.832	1.00
93_P	97_A	0.829	1.00
25_R	28_A	0.825	1.00
30_T	41_V	0.821	1.00
60_A	64_L	0.818	1.00
94_V	98_G	0.813	1.00
36_P	87_L	0.807	1.00
101_L	105_L	0.801	1.00
81_S	85_V	0.801	1.00
103_N	107_A	0.801	1.00
11_L	61_D	0.797	1.00
60_A	63_M	0.792	1.00
42_V	45_V	0.781	0.99
86_A	90_A	0.776	0.99
58_A	62_T	0.774	0.99
111_V	114_A	0.766	0.99
26_V	30_T	0.762	0.99
47_S	111_V	0.761	0.99
112_A	115_W	0.751	0.99
98_G	102_G	0.743	0.99
81_S	111_V	0.742	0.99
59_D	62_T	0.741	0.99
12_V	15_G	0.738	0.99
33_T	37_A	0.738	0.99
108_G	111_V	0.728	0.99
52_A	117_L	0.719	0.99
22_L	26_V	0.714	0.99
48_F	55_F	0.709	0.99
37_A	41_V	0.703	0.99
51_A	111_V	0.700	0.99
70_A	73_A	0.698	0.99
61_D	64_L	0.693	0.99
82_V	86_A	0.692	0.99
27_V	83_D	0.689	0.99
52_A	114_A	0.689	0.99
53_L	57_A	0.683	0.99
9_A	64_L	0.683	0.99
96_A	104_L	0.682	0.99
80_F	100_A	0.678	0.99
80_F	107_A	0.668	0.98
62_T	66_F	0.659	0.98
57_A	67_G	0.657	0.98
70_A	74_F	0.647	0.98
47_S	81_S	0.646	0.98
64_L	67_G	0.645	0.98
77_F	81_S	0.627	0.98
62_T	65_L	0.627	0.98
87_L	99_H	0.626	0.98
47_S	50_L	0.614	0.97
12_V	91_D	0.606	0.97
18_L	22_L	0.605	0.97
26_V	74_F	0.601	0.97
40_L	103_N	0.601	0.97
26_V	41_V	0.588	0.97
109_L	113_L	0.581	0.96
81_S	84_V	0.581	0.96
11_L	65_L	0.581	0.96
8_P	61_D	0.581	0.96
95_A	99_H	0.578	0.96
34_E	92_R	0.576	0.96
33_T	95_A	0.572	0.96
109_L	112_A	0.563	0.96
23_R	69_G	0.563	0.96
49_V	66_F	0.560	0.95
20_A	71_C	0.559	0.95
82_V	111_V	0.558	0.95
40_L	95_A	0.558	0.95
14_A	18_L	0.557	0.95
110_A	113_L	0.553	0.95
18_L	21_V	0.551	0.95
9_A	25_R	0.547	0.95
26_V	45_V	0.545	0.95
15_G	80_F	0.542	0.95
15_G	70_A	0.540	0.94
100_A	104_L	0.539	0.94
105_L	109_L	0.538	0.94
51_A	114_A	0.537	0.94
26_V	38_G	0.535	0.94
67_G	79_S	0.534	0.94
22_L	25_R	0.533	0.94
39_T	76_T	0.531	0.94
12_V	73_A	0.528	0.94
9_A	13_A	0.523	0.93
89_D	115_W	0.517	0.93
10_V	14_A	0.515	0.93
51_A	55_F	0.513	0.93
35_Y	38_G	0.511	0.93
27_V	39_T	0.509	0.93
35_Y	87_L	0.503	0.92
73_A	80_F	0.502	0.92
113_L	117_L	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ldsA	2	0.9832	15.3	0.909	Contact Map
4j05A	3	0.9832	10.5	0.916	Contact Map
4tphA	2	0.9748	8.4	0.919	Contact Map
4xnjA	1	0.9916	7.9	0.92	Contact Map
4ikvA	1	0.9916	6.9	0.922	Contact Map
4gc0A	1	0.9832	6.4	0.923	Contact Map
3wdoA	1	0.9664	5.4	0.926	Contact Map
4q65A	1	0.9916	5.2	0.926	Contact Map
1pw4A	1	0.9664	4.5	0.929	Contact Map
4oh3A	2	0.9916	4.5	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.