CRCB2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CRCB2 - Putative fluoride ion transporter CrcB 2

UniProt:	Q9HNW1	Sequences: MGIPLRIDARSTALVAVGGAVGAVLRYTVAQAIAGPLGTLAANAAGSLALGALAYEAAATDSVLSADAHTLLGTGCLSAFTTYSTFAVQTAGLAPRWMAANVATTYALGFAGVLVGRAIAATARGDRR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	128 (111)
Sequences:	3343 (2482)
Seq/√Len:	235.5

ECOLI - CRCB
BACSU - CRCB2 CRCB1
HALSA - CRCB2 CRCB1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
46_G	81_T	4.219	1.00
45_A	80_F	4.041	1.00
16_A	20_A	3.326	1.00
19_G	23_A	3.277	1.00
50_L	73_G	2.952	1.00
101_N	105_T	2.338	1.00
44_A	112_G	2.299	1.00
52_A	120_A	2.142	1.00
25_L	76_C	2.120	1.00
29_V	42_A	2.065	1.00
18_G	71_L	2.039	1.00
44_A	108_L	2.006	1.00
90_T	102_V	1.928	1.00
20_A	79_A	1.901	1.00
47_S	109_G	1.848	1.00
53_L	72_L	1.822	1.00
90_T	101_N	1.710	1.00
55_Y	117_R	1.700	1.00
21_V	71_L	1.677	1.00
90_T	98_M	1.617	1.00
50_L	77_L	1.606	1.00
48_L	119_I	1.595	1.00
21_V	76_C	1.553	1.00
48_L	116_G	1.547	1.00
40_L	104_T	1.485	1.00
42_A	80_F	1.448	1.00
28_T	32_A	1.420	1.00
49_A	77_L	1.407	1.00
41_A	45_A	1.397	1.00
53_L	73_G	1.374	1.00
25_L	80_F	1.374	1.00
50_L	113_V	1.370	1.00
11_S	70_T	1.352	1.00
27_Y	31_Q	1.325	1.00
12_T	24_V	1.303	1.00
24_V	28_T	1.298	1.00
23_A	79_A	1.276	1.00
94_A	97_W	1.250	1.00
116_G	120_A	1.233	1.00
30_A	42_A	1.230	1.00
55_Y	59_A	1.224	1.00
16_A	24_V	1.208	1.00
50_L	79_A	1.207	1.00
33_I	38_G	1.182	1.00
71_L	76_C	1.160	1.00
20_A	24_V	1.159	1.00
55_Y	120_A	1.144	1.00
70_T	74_T	1.126	1.00
40_L	108_L	1.105	1.00
54_A	73_G	1.067	1.00
99_A	103_A	1.043	1.00
48_L	112_G	1.033	1.00
114_L	118_A	1.019	1.00
91_A	113_V	1.012	1.00
104_T	108_L	0.969	1.00
54_A	88_V	0.958	1.00
51_G	113_V	0.949	1.00
52_A	56_E	0.947	1.00
87_A	91_A	0.943	1.00
95_P	99_A	0.943	1.00
96_R	99_A	0.922	1.00
38_G	42_A	0.921	1.00
30_A	39_T	0.918	1.00
39_T	89_Q	0.902	1.00
36_P	93_L	0.895	0.99
37_L	41_A	0.891	0.99
86_F	102_V	0.883	0.99
103_A	107_A	0.875	0.99
87_A	113_V	0.862	0.99
76_C	80_F	0.853	0.99
65_S	68_A	0.852	0.99
86_F	109_G	0.851	0.99
42_A	45_A	0.845	0.99
48_L	55_Y	0.835	0.99
30_A	89_Q	0.829	0.99
14_L	67_D	0.823	0.99
28_T	31_Q	0.812	0.99
69_H	73_G	0.805	0.99
14_L	71_L	0.802	0.99
40_L	44_A	0.796	0.99
23_A	77_L	0.792	0.99
33_I	41_A	0.791	0.99
105_T	109_G	0.790	0.99
29_V	41_A	0.784	0.99
30_A	34_A	0.782	0.99
64_L	68_A	0.779	0.99
85_T	89_Q	0.776	0.99
96_R	100_A	0.768	0.98
17_V	20_A	0.768	0.98
93_L	101_N	0.764	0.98
54_A	117_R	0.738	0.98
47_S	113_V	0.716	0.98
15_V	70_T	0.715	0.98
40_L	105_T	0.715	0.98
89_Q	92_G	0.714	0.98
117_R	121_A	0.712	0.97
52_A	55_Y	0.704	0.97
49_A	72_L	0.688	0.97
31_Q	35_G	0.687	0.97
91_A	114_L	0.678	0.97
68_A	71_L	0.676	0.97
108_L	112_G	0.675	0.97
53_L	57_A	0.674	0.96
115_V	118_A	0.661	0.96
40_L	97_W	0.657	0.96
57_A	73_G	0.653	0.96
106_Y	110_F	0.645	0.95
59_A	120_A	0.642	0.95
118_A	121_A	0.635	0.95
91_A	117_R	0.629	0.95
28_T	38_G	0.628	0.95
52_A	116_G	0.615	0.94
76_C	79_A	0.612	0.94
36_P	89_Q	0.611	0.94
15_V	24_V	0.611	0.94
13_A	17_V	0.608	0.94
21_V	25_L	0.607	0.94
88_V	92_G	0.598	0.93
110_F	113_V	0.597	0.93
100_A	104_T	0.595	0.93
59_A	62_S	0.592	0.93
102_V	106_Y	0.588	0.93
51_G	71_L	0.588	0.93
97_W	100_A	0.587	0.93
11_S	67_D	0.586	0.93
27_Y	30_A	0.582	0.92
115_V	119_I	0.578	0.92
119_I	122_T	0.577	0.92
29_V	80_F	0.576	0.92
47_S	87_A	0.573	0.92
104_T	107_A	0.571	0.92
47_S	77_L	0.570	0.92
49_A	52_A	0.570	0.92
32_A	35_G	0.569	0.92
56_E	60_T	0.566	0.91
18_G	86_F	0.564	0.91
54_A	58_A	0.560	0.91
59_A	121_A	0.558	0.91
16_A	19_G	0.557	0.91
52_A	119_I	0.554	0.90
15_V	18_G	0.554	0.90
12_T	28_T	0.553	0.90
35_G	119_I	0.552	0.90
39_T	43_N	0.551	0.90
86_F	106_Y	0.548	0.90
66_A	70_T	0.545	0.90
114_L	117_R	0.544	0.90
53_L	64_L	0.536	0.89
34_A	38_G	0.530	0.88
101_N	109_G	0.526	0.88
31_Q	42_A	0.524	0.88
57_A	60_T	0.522	0.88
83_Y	87_A	0.521	0.88
74_T	85_T	0.520	0.87
12_T	70_T	0.520	0.87
68_A	72_L	0.516	0.87
29_V	33_I	0.513	0.87
57_A	64_L	0.508	0.86
47_S	110_F	0.507	0.86
25_L	29_V	0.504	0.86
39_T	82_T	0.504	0.86
64_L	67_D	0.503	0.86
19_G	101_N	0.502	0.86
29_V	38_G	0.501	0.85
21_V	24_V	0.500	0.85
12_T	54_A	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3tdsE	3	0.5469	8.9	0.925	Contact Map
4q65A	1	0.5156	7.8	0.927	Contact Map
2kv5A	1	0.2344	7.1	0.928	Contact Map
4fc4A	3	0.4531	6.1	0.93	Contact Map
1pw4A	1	0.9922	5.5	0.932	Contact Map
4j05A	3	0.8906	5.1	0.933	Contact Map
4b19A	1	0.2266	5.1	0.933	Contact Map
2l2tA	2	0.2969	4.6	0.934	Contact Map
2cfqA	1	0.9531	4.2	0.935	Contact Map
4tphA	2	0.5234	4.2	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.